www.BuyersGuideChem.com - directory for chemicals and chemical suppliers
Productname:

BGC > Chemicals A-Z > Calcitonin (rat)

Calcitonin (rat)

Structure
Quick view: Suppliers
BGC Id:
661618953222
CAS No.:
Synonyms:
thyrocalcitonin rat | l-prolinamide,l-cysteinylglycyl-l-asparaginyl-l-leucyl-l-seryl-l-threonyl-l-cysteinyl-l-methionyl-l-leucylglycyl-l-threonyl-l-tyrosyl-l-threonyl-l-glutaminyl-l-a-aspartyl-l-leucyl-l-asparaginyl-l-lysyl-l-phenylalanyl-l-histidyl-l-threonyl-l-phenylalanyl-l-prolyl-l-glutaminyl-l-threonyl-l-seryl-l-isoleucylglycyl-l-valylglycyl-l-alanyl-,cyclic (1® | h-cys-gly-asn-leu-ser-thr-cys-met-leu-gly-thr-tyr-thr-gln-asp-leu-asn-lys-phe-his-thr-phe-pro-gln-thr-ser-ile-gly-val-gly-ala-pro-nh2 | cys-gly-asn-leu-ser-thr-cys-met-leu-gly-thr-tyr-thr-gln-asp-leu-asn-lys-phe-his-thr-phe-pro-gln-thr-ser-ile-gly-val-gly-ala-pro-nh2 rat | rat calcitonin | calcitonin (rat) (9ci) | 7)-disulfide | calcitonin, rat | 1,2-dithia-5,8,11,14,17,20-hexaazacyclotricosane, cyclic peptide deriv. | calcitonin(human), 16-l-leucine-26-l-serine- | cgnlstcmlgtytqdlnkfhtfpqtsigvgap-nh2 (disulfide bridge: 1-7) | h-cys-gly-asn-leu-ser-thr-cys-met-leu-gly-thr-tyr-thr-gln-asp-leu-asn-lys-phe-his-thr-phe-pro-gln-thr-ser-ile-gly-val-gly-ala-pro-nh2 (disulfide bridge: 1-7) | thyrocalcitonin (rat) (8ci) | calcitoninrat,calcitoninra
Formula:
C148H228 N40 O46 S3
Molecular Weight:
3399.83

List of Suppliers

Bachem AG

Company type: Leading producer
About Bachem Bachem is a listed technology-based company focused on peptide chemistry. Bachem AG is a seller of Uremic Pentapeptide. Bachem AG is supplier for Calcitonin (rat). The company provides a full range of services to the pharma and biotech industries. It specializes in the development of innovative, efficient manufacturing processes and the reliable production of peptide-based active pharmaceutical ingredients. A comprehensive catalog of biochemicals and exclusive custom syntheses for research labs complete the service portfolio. Headquartered in Swi ...
Country: Switzerland   Phone: +41 58 595 2021   Telefax: +41 58 595 2040

Chemos GmbH & Co. KG

Company type: Supplier of chemical products
Chemos is a leading supplier of chemical specialties for your research and production needs. We are supplier of 7-(alpha-D-Glucopyranosyloxy)-5-hydroxy-2-(4-hydroxyphenyl)-4H-1-benzopyran-4-one. Everything new starts small and needs specific support during scale up and production. With over 25 years of experience in the fine chemical market Chemos is supporting research institutions and chemical companies in Europe and America. Chemos GmbH & Co. KG is supplier for Calcitonin (rat). Chemos is a sourcing and distribution company with a grown and strong network of custom manufacturing companies and chemical producers from around the ...
Country: Germany   Phone: +49-871-966346-0   Telefax: +49-871-966346-13

BuGuCh & Partners

Company type: Analytical Institution
We, BuGuCh & Partners, are an international acting and innovative company, leading in developing and manufacturing. We operates major facilities in North America, Europe and the Pacific Rim, as well as facilities in China, Japan and Saudi Arabia operated through joint ventures. We maintain independently or are partners of some production sites in Europe, Asia and South America. BuGuCh & Partners is supplier for Calcitonin (rat). BuGuCh & Partners is a seller of 3,5-Difluoro-4-methoxybenzylamine. Our global network is a strength. Our products range from natural gas, oil and basic chemi ...
Country: Germany   Phone:   Telefax:

Leap Chem Co., Ltd

Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production. LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities. Leap Chem Co., Ltd is supplier for Calcitonin (rat). We are supplier of 4-Bromophenylacetate. As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. Our client list includes many m ...
Country: P.R.China   Phone: +852-30606658   Telefax:

Safety Information

WGK Germany:
3
Storage tempuraturx:
-20°C

Most viewed

Within the past time user are also interested in the following chemicals.


Related products:


Language:
english português français deutsch español
svensk norsk italiano 中国 日本語 по-русски




How do you find
new customers?

click here


Health Biochem Technolo
Health Biochem Technology Co., Ltd. (Hong Kong) was founded in 2015, the group headquarters is loca


Tianjin Security Techno
Tianjin Security Technology Development Ltd Co. is a hi-tech enterprise with self-governed legal pe


Prakash Chemicals Inter
Prakash Chemicals International Pvt. Ltd. (PCIPL) today, stands as an archetype of unmatched qualit


Anhui Chufeng Medical T
Chufeng was established in 2020, located in Innovation Industrial Park in Hefei High-tech district,


Shouguang Nuomeng Chemi
Shouguang Nuomeng Chemical Co., Ltd., established in 2008, is located in Houzhen Industrial Park of


BuGuCh & Partners
We, BuGuCh & Partners, are an international acting and innovative company, leading in developin


© Copyright 1996 to 2024 by Netvertise GmbH. All rights reserved Calcitonin (rat)