|
|
Calcitonin (chicken)
Synonyms: cys-ala-ser-leu-ser-thr-cys-val-leu-gly-lys-leu-ser-gln-glu-leu-his-lys-leu-gln-thr-tyr-pro-arg-thr-asp-val-gly-ala-gly-thr-pro-nh2 [disulfide bridge: 1–7] | calcitonin, chicken | calcitonin (salmon),2-l-alanine-3-l-serine-26-l-aspartic acid-27-l-valine-29-l-alanine- | chicken thyrocalcitonin | h-cys-ala-ser-leu-ser-thr-cys-val-leu-gly-lys-leu-ser-gln-glu-leu-his-lys-leu-gln-thr-tyr-pro-arg-thr-asp-val-gly-ala-gly-thr-pro-nh2 | caslstcvlgklsqelhklqtyprtdvgagtp-nh2 | caslstcvlgklsqelhklqtyprtdvgagtp-nh2 (disulfide bridge: 1-7) | h-cys-ala-ser-leu-ser-thr-cys-val-leu-gly-lys-leu-ser-gln-glu-leu-his-lys-leu-gln-thr-tyr-pro-arg-thr-asp-val-gly-ala-gly-thr-pro-nh2 (disulfide bridge: 1-7) | 1,2-dithia-5,8,11,14,17,20-hexaazacyclotricosane, cyclic peptide deriv. | thyrocalcitonin from chicken | calcitonin (chicken)(9ci) | chicken calcitonin
Formula: C145H240 N42 O46 S2
List of Suppliers
Bachem AG
Company type: Leading producer
About Bachem
Bachem is a listed technology-based company focused on peptide chemistry. Bachem AG is supplier for Calcitonin (chicken). The company provides a full range of services to the pharma and biotech industries. It specializes in the development of innovative, efficient manufacturing processes and the reliable production of peptide-based active pharmaceutical ingredients. A comprehensive catalog of biochemicals and exclusive custom syntheses for research labs complete the service portfolio. We provide Acetyl-(D-Val13)-a-MSH (11-13) as well. Headquartered in Swi ...
Country: Switzerland
Phone: +41 58 595 2021
Telefax: +41 58 595 2040
Chemos GmbH & Co. KG
Company type: Supplier of chemical products
Chemos is a leading supplier of chemical specialties for your research and production needs. Chemos GmbH & Co. KG is supplier for Calcitonin (chicken). Ethotoin is also served by Chemos GmbH & Co. KG. Everything new starts small and needs specific support during scale up and production. With over 25 years of experience in the fine chemical market Chemos is supporting research institutions and chemical companies in Europe and America. Chemos is a sourcing and distribution company with a grown and strong network of custom manufacturing companies and chemical producers from around the ...
Country: Germany
Phone: +49-871-966346-0
Telefax: +49-871-966346-13
BuGuCh & Partners
Company type: Analytical Institution
We, BuGuCh & Partners, are an international acting and innovative company, leading in developing and manufacturing.
We operates major facilities in North America, Europe and the Pacific Rim, as well as facilities in China, Japan and Saudi Arabia operated through joint ventures.
We maintain independently or are partners of some production sites in Europe, Asia and South America. We provide Dimethyldibenzofuran as well. BuGuCh & Partners is supplier for Calcitonin (chicken). Our global network is a strength.
Our products range from natural gas, oil and basic chemi ...
Country: Germany
Phone:
Telefax:
Safety Information
Storage tempuraturx: -15°C
Most viewed
Within the past time user are also interested in the following chemicals.
5-Chloropyrazine-2-carboxylic acid
3,3'-Dimethyl-4,4'-biphenylene diisocyanate
Related products:
|
|
|
How do you find new customers?
click here
Samyang Fine Chemical C
Samyang Fine Chemical has contributed greatly to the development of Korean chemical industry by coo
Prakash Chemicals Inter
Prakash Chemicals International Pvt. Ltd. (PCIPL) today, stands as an archetype of unmatched qualit
JieJie Group Co., Ltd.
Shanghai JieJie Chemical Co., Ltd is a pharmaceutical and chemical enterprise for the research and
Vistachem Europe GmbH
As reliable providers of chemicals from across the globe, our world-wide web sources and supplies t
Chemlyte Solutions
At Chemlyte Solutions, we place long-term relationships and outstanding client experience at the he
Nantong Baihua Bio-phar
We are a global supplier for pharmaceutical intermediates, fine chemicals, building blocks, rare co
|