|
|
Calcitonin (eel)
Synonyms: miacalcic | thyrocalcitonin eel | eel calcitonin | asu 1-7 | calcitonin (eel) (9ci) | eel thyrocalcitonin | h-cys-ser-asn-leu-ser-thr-cys-val-leu-gly-lys-leu-ser-gln-glu-leu-his-lys-leu-gln-thr-tyr-pro-arg-thr-asp-val-gly-ala-gly-thr-pro-nh2 | csnlstcvlgklsqelhklqtyprtdvgagtp-nh2 | calcitonin, eel | csnlstcvlgklsqelhklqtyprtdvgagtp-nh2 (disulfide bridge: 1-7)
List of Suppliers
Conscientia Industrial Co., Ltd (Zhejiang Conscientia Pharmaceutical)
Company type: Producer
Conscientia Industrial Co., Ltd (Conscientia Pharm) mainly engages in developing, manufacturing, marketing, APIs (Active Pharmaceutical Ingredients), pharmaceutical intermediates. Conscientia Industrial Co., Ltd (Zhejiang Conscientia Pharmaceutical) is supplier for Calcitonin (eel). Conscientia Industrial Co., Ltd (Zhejiang Conscientia Pharmaceutical) is a seller of Uridine 5'-triphosphate trisodium salt 2-hydrate. Besides, we provide services of custom synthesis and contract manufacturing APIs (Active Pharmaceutical Ingredients), intermediates, fine chemicals for generic and new drugs.
Conscientia Industrial aims to be world-class pharmaceutical raw materials supplier through unflagging efforts in quality, i ...
Country: P.R.China
Phone: +86 170 9858 0209
Telefax: +86 170 9858 0209
Lori Industry Co., Ltd
Company type: Producer
Lori industry Co., Ltd was established in 2002 years. It is a large-scale manufacturer integrating R&D, produce and sales. We sell 2-Chloropropane as well. Lori Industry Co., Ltd is supplier for Calcitonin (eel). Our products mainly cover fine chemicals, organic intermediates, biological buffers, agricultural fertilizers and other chemicals .
Among them, the sales proportion of organic chemicals and agricultural fertilizers is at the forefront of the domestic market. From 2013 to 2022 years, through cooperation with foreign trade companies, customers vis ...
Country:
Phone: +86-13011713125
Telefax: +86-13011713125
Bachem AG
Company type: Leading producer
About Bachem
Bachem is a listed technology-based company focused on peptide chemistry. The company provides a full range of services to the pharma and biotech industries. It specializes in the development of innovative, efficient manufacturing processes and the reliable production of peptide-based active pharmaceutical ingredients. We are supplier of Z-Asu(OtBu)-OH . DCHA. Bachem AG is supplier for Calcitonin (eel). A comprehensive catalog of biochemicals and exclusive custom syntheses for research labs complete the service portfolio. Headquartered in Swi ...
Country: Switzerland
Phone: +41 58 595 2021
Telefax: +41 58 595 2040
BOC Sciences
Company type: Supplier
BOC Sciences provides a wide range of customer services, bulk and specialty compounds to the pharmaceutical, agrochemical and biotechnology industries. BOC Sciences also offers . We intend to offer you the products and services of the highest quality at the most reasonable, cost efficient prices. BOC Sciences is supplier for Calcitonin (eel). Most of our compounds can be supplied ranging from mg to kg and arrive with analytic report. We hope to add immense value to your research projects!
Country: USA
Phone: +1-631-485-4226
Telefax: +1-631-614-7828
BuGuCh & Partners
Company type: Analytical Institution
We, BuGuCh & Partners, are an international acting and innovative company, leading in developing and manufacturing.
We operates major facilities in North America, Europe and the Pacific Rim, as well as facilities in China, Japan and Saudi Arabia operated through joint ventures.
We maintain independently or are partners of some production sites in Europe, Asia and South America. BuGuCh & Partners is supplier for Calcitonin (eel). We are supplier of di-p-Tolyl sulfone. Our global network is a strength.
Our products range from natural gas, oil and basic chemi ...
Country: Germany
Phone:
Telefax:
Leap Chem Co., Ltd
Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production. Leap Chem Co., Ltd is supplier for Calcitonin (eel).
LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities. We sell tert-Butyldimethylsilylimidazole as well.
As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner.
Our client list includes many m ...
Country: P.R.China
Phone: +852-30606658
Telefax:
Safety Information
Storage tempuraturx: -20°C
Most viewed
Within the past time user are also interested in the following chemicals.
Balsalazide disodium 2-hydrate
Suppliers and manufactures - with identical CAS number as Calcitonin (eel)
For the following products supplier are listed below:
Elcatonin acetate
Chemos GmbH & Co. KG
Company type: Supplier of chemical products
Chemos is a leading supplier of chemical specialties for your research and production needs. We supply our chemical product 1-[[[3-[[(aziridin-1-ylcarbonyl)amino]methyl]-3,5,5-trimethylcyclohexyl]amino]carbonyl]aziridine. Everything new starts small and needs specific support during scale up and production. With over 25 years of experience in the fine chemical market Chemos is supporting research institutions and chemical companies in Europe and America. Chemos is a sourcing and distribution company with a grown and strong network of custom manufacturing companies and chemical producers from around the ...
Country: Germany
Phone: +49-871-966346-0
Telefax: +49-871-966346-13
Simagchem Corporation
Company type: Bulk chemical producer
Your partner in China for chemicals business. We provide Phenyltrichlorosilane as well.
Expertize in supplies and sources of fine, specialty, pharmaceutical chemicals and intermediates.
WE offer high quality products and JIT services with instant market intelligence in China, custom synthesis in our 3 production sites, famous principals as Brenntag, Univar,S inopec, Grace, Petrobras, DKSH, Formitex, Evonik, Merck, TCI, Sanofi, Chemo with creditable reputation and business cooperation.
Country: P.R.China
Phone: +86 592 2680 277
Telefax: +86 592 2680 237
Hangzhou Lingrui Chemical Co., Ltd.
Company type: Producer
Established in 2010, located in Hangzhou Qinglan science park, lingruichem is a technical company mainly focus on the Custom synthesis, manufacturing, sales of chemicals to various industries. In our R&D centre, we have a staff of skilled and experienced research chemists. This has enabled us to meet the special requirements of our customers and it has enabled us to provide quality products at competitive prices. We sell 4,4'-Dichlorodiphenyl sulfone as well.
Lingruis credo is committed to your reliable business par ...
Country: P.R.China
Phone: +86-571-88092529
Telefax: +86-571-87334908
Related products:
|
|
|
How do you find new customers?
click here
Chemtour Biotech Co., L
Founded in 2014, Chemtour is specializing in providing pharmaceutical raw materials and chemicals f
Rieke Metals LLC
Rieke Metals Inc. (RMI) began in 1991 with its foundation in over 40 years of research in active me
Nantong Baihua Bio-phar
We are a global supplier for pharmaceutical intermediates, fine chemicals, building blocks, rare co
Tianjin Security Techno
Tianjin Security Technology Development Ltd Co. is a hi-tech enterprise with self-governed legal pe
Xi´an SR Bio-Engineerin
Xi'an SR Bio-Engineering Co., Ltd established in 2009, is an expert in the field of biochemistry, p
polypeptide.ltd
Xuchang Shangke Chemical Co., Ltd. (Phcoker / Polypeptide.ltd) was founded in 2008, located in the
|