www.BuyersGuideChem.com - directory for chemicals and chemical suppliers


BGC > Chemicals A-Z > Calcitonin, Salmon

Suppliers for
Calcitonin, Salmon

List of Suppliers

Sigma-Aldrich International GmbH

Company type: Bulk and laboratory supplier
Our purpose is to solve the toughest problems in life science by collaborating with the global scientific community – and through that, we aim to accelerate access to better health for people everywhere. We provide scientists and engineers with best-in-class lab materials, technologies and services. Sigma-Aldrich International GmbH is supplier for Calcitonin, Salmon. We provide 4-Hydroxy-3-tert-Butylanisole as well. With the 2015 combination of Merck Millipore and Sigma-Aldrich, we now have a broad portfolio of 300,000 products and an expanded global footprint. We are dedica ...
Country: Switzerland   Phone: +41 81 755 28 28   Telefax: +41 81 755 28 15

LGM Pharma

Company type: Supplier
Supplying the newest API’s and rarest molecules for your R&D needs. Additionally Gramicidin is supplied by us. LGM Pharma is supplier for Calcitonin, Salmon. We at LGM Pharma are leaders in supplying the worlds leading institutions with their raw materials for the research and development of the most cutting edge molecules and API’s. LGM Pharma provides our customers with full support from assistance sourcing the molecules needed for research to finding a manufacturer with the right regulatory capabilities for full product development - from the earl ...
Country: USA   Phone: +1-800-881-8210   Telefax: +1-615-250-9817

Leap Labchem Co., Ltd

Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production. LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities. Leap Labchem Co., Ltd is a seller of Ketene diethyl acetal. As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. Leap Labchem Co., Ltd is supplier for Calcitonin, Salmon. Our client list includes many m ...
Country: P.R.China   Phone: +86-571-87756549   Telefax: +86-571-87755464

Santa Cruz Biotechnology, Inc.

Company type: International Supplier
Santa Cruz Biotechnology, Inc. now offers over 140,000 specialty biochemicals under our ChemCruz™ brand. Santa Cruz Biotechnology, Inc. is supplier for Calcitonin, Salmon. Santa Cruz Biotechnology, Inc. is focused on the ongoing development of research reagents. Santa Cruz Biotechnology, Inc. is a seller of 1-Ethynyl naphthalene. It is our goal to continue to offer the broadest range of reagents in the field. We also provide superior, innovative primary antibodies and support products.
Country: USA   Phone: +1 800-457-3802   Telefax: +1-831-457-3802

Chemieliva Pharmaceutical Co., Ltd.

Company type: Leading producer
Chemieliva is a key hi-tech enterprise, engaged in the field of Pharmaceutical & Intermediates. Chemieliva is famous for its high technology, and highly-optimized R&D technology, marketing and human resources. Chemieliva Pharmaceutical Co., Ltd. is supplier for Calcitonin, Salmon. Powered by this, Chemieliva is specialized on developing and producing generics drugs and pharmaceutical intermediates. Chemieliva Pharmaceutical Co., Ltd. also offers 4-n-Propylbenzylamine. With these advantages, our logistic department will make the goods delivered at customer’s appointed destination safely in the shortest ...
Country: P.R.China   Phone: +86 23 677 702 19   Telefax: +86 23 677 702 20

Acinopeptide Co., Ltd.

Company type: Leading Producer
Acinopeptide Co., Ltd. is supplier for Calcitonin, Salmon. We sell Apelin-36 (human) as well. Acinopeptide is expert on Peptide & Amino Derivatives _________________________________________ PRODUCT LINE: + Pharmaceutical Peptide + cosmetic peptide + catalogue peptides + Antimicrobial Peptides + Amino Acid Derivatives + Alpha-Amino Acids + Beta-Amino Acids + Beta-Homo Amino Acids + Peptide custom synthesis + Nucleotides _________________________________________ OUR ADVANTAGE IN THE ...
Country: P.R.China   Phone: +86 28 61 98 77 05   Telefax: +86 28 61 98 77 05

Product Details

Properties: Productname(s) : Calcitonin, Salmon / Molecular Structure : / Formula : C145H240N44O48S2 / Molecular Weight : 3431.85 / Synonyms : tz-ct ; thyrocalcitonin ; salmotonin ; calcitoran ; calcimar ; salmon calcium ; salcatonin ; salmon ; cibacalcin ; salcitonin / Density : / Boiling Point : / Flash Point : / Melting Point : / Hazard Symbols : / Risk Codes : / Safety : / Superlist Name : / Solubility : 0.05 M acetic acid: 1 mg/mL, clear, colorless / Appearance : / EINECS : 256-342-8 / Transport Information : / Source : / Particular : / Availableforms : / Occurrence : / Method : /
... more properties and specification of Calcitonin, Salmon

Most viewed

Within the past time user are also interested in the following chemicals.

Suppliers and manufactures - with identical CAS number as Calcitonin, Salmon

For the following products supplier are listed below:
    Salcatonin acetate
    Calcitonin (salmon I)
    Calcitonin acetate
    Salmon calcitonin
    Salmon calcitonin acetate
    Calcitonin (salmon) Ph. Eur. (GMP)
    Calcitonin, salmon;CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2(Disulfidebridge:1-7)

Ad for Chemistry Equipment

Supplier for

Salcatonin acetate

(CAS: 47931-85-1)

Chemos GmbH & Co. KG

Company type: Supplier of chemical products
Chemos is a leading supplier of chemical specialties for your research and production needs. Everything new starts small and needs specific support during scale up and production. With over 25 years of experience in the fine chemical market Chemos is supporting research institutions and chemical companies in Europe and America. We are seller of 4-Bromopicolinic acid. Chemos is a sourcing and distribution company with a grown and strong network of custom manufacturing companies and chemical producers from around the ...
Country: Germany   Phone: +49-9402-9336 0   Telefax: +49-9402-933 613

Skyrun Industrial Co., Ltd.

Company type: Leading producer
Skyrun Industrial Co.Limited, established in 2003, a state-controlled company (By Skyrun Corp. & High Hope) in China, specializing in developing, producing and handing raw pharmaceutical material and intermediates. We have expanded a compositive entity from initially only as a small manufacturer. 4-Methyl-1-(3-methylbenzoyl)piperidine is also served by Skyrun Industrial Co., Ltd.. We have extensive knowledge of domestic and international pharmaceutical markets. Our working range can be start from small amount in research stage to big bulk for industrial produc ...
Country: P.R.China   Phone: +86-576-84015261   Telefax: +86-576-84015261
Ad for Chemistry Equipment

Supplier for


(CAS: 47931-85-1)

Chemos GmbH & Co. KG

Company type: Supplier of chemical products
Chemos is a leading supplier of chemical specialties for your research and production needs. Everything new starts small and needs specific support during scale up and production. 4-Bromopicolinic acid will be also provided by us. With over 25 years of experience in the fine chemical market Chemos is supporting research institutions and chemical companies in Europe and America. Chemos is a sourcing and distribution company with a grown and strong network of custom manufacturing companies and chemical producers from around the ...
Country: Germany   Phone: +49-9402-9336 0   Telefax: +49-9402-933 613

Hangzhou Dayangchem Co. Ltd.

Company type: Leading producer
Hangzhou DayangChem Co. Ltd is a comprehensive entity which specializes in development, production and trade of pharmaceutical, agrochemical and dyestuff intermediates as well as some special type reagents. We sell 1-Cyclopropyl-4-nitrobenzene as well. We have an own factory and share enterprises. We act also as agent of many chemical factories and promote their products to the international market at very competitive price. We take "Credi first, Clients supreme" as our aim. We expect to cooperate with more partners ...
Country: P.R.China   Phone: +86-571-88938639   Telefax: +86-571-8893-8652
Ad for Chemistry Equipment

Supplier for

Calcitonin (salmon I)

(CAS: 47931-85-1)

Pharmacore Co., Limited

Company type: Producer
PHARMACORE CO., LIMITED is a source for drug and intermediates. The company has research and development facilities to produce organic intermediates that have the potential to become drugs of the future. Pharmacore Co., Limited is a seller of 5-(Methoxycarbonyl)-1-methyl-1H-pyrazole-3-carboxylic acid. It offers screening compounds that accelerate drug discovery programs. The company is dedicated to discovering molecules. Following is our Outstanding Service: ØResearch and Development of synthesis for the production of most complex molecules. Ø ...
Country: P.R.China   Phone: +86-21-20242659   Telefax: +86-21-20242659

Bachem AG

Company type: Leading producer
About Bachem Bachem is a listed technology-based company focused on peptide chemistry. The company provides a full range of services to the pharma and biotech industries. It specializes in the development of innovative, efficient manufacturing processes and the reliable production of peptide-based active pharmaceutical ingredients. We supply our chemical product H-Pro-His-Gly-OH. A comprehensive catalog of biochemicals and exclusive custom syntheses for research labs complete the service portfolio. Headquartered in Swi ...
Country: Switzerland   Phone: +41 58 595 2040   Telefax: +41 58 595 2020
Ad for Chemistry Equipment

Supplier for

Calcitonin acetate

(CAS: 47931-85-1)

Gihi Chemicals Co., Limited

Company type: Producer
We are has expanded a compositive entity from initially only as a small manufacturer. The company dedicated to the development, production and marketing of chemicals. GIHI CHEMICALS covers whole range from small amount (gram grade) for research to big bulk for industrial production. Synthesis capacity from 1 liter to 5000 liter is available. Gihi Chemicals Co., Limited also offers Trastuzumab. GIHI CHEMICALS focus on: - Organic compounds - Active Pharmaceutical Ingredient(s) - Nutritional prod ...
Country: P.R.China   Phone: +86-571-86217390   Telefax: +86-571-86217391
Ad for Chemistry Equipment

Supplier for


(CAS: 47931-85-1)

Kinbester Co., Ltd.

Company type: Bulk chemical supplier
Kinbester Co., Limited is a leading technology based supplier of organic chemicals in China. The major businesses of our company are: 1. Supply high purity organic reagent. 2. Supply intermediates for pharmaceuticals, agrochemicals, dyestuff, electro-chemicals, cosmetics, perfume etc. 3. Custom manufacturing and co-developing new chemicals under signing secret agreements. 4. We provide 5-Bromoindole as well. Investment in fields of pharmaceuticals and intermediates ...
Country: P.R.China   Phone: +86-592-5550592   Telefax: +86-592-5550518

Zhejiang Jiasi Chemical Co., Ltd.

Company type: Leading producer
Zhejiang Jiasi Chemical Co.,Ltd, approved by ISO9001:2000 is specialized in manufacturing fine chemicals.  Our company is engaged in providing fine chemicals, including pharmaceutical intermediates, alkynyl alcohols nonionic surfactant as defoaming and wetting agent, liquid crystal and electron chemicals, sensitization & photochromism materials, light initiator and special high polymer monomer etc. We sell Propafenone.HCl as well. Furthermore, we specialize in Grignard Reaction& ...
Country: P.R.China   Phone: +86-574-26889102   Telefax: +86-574-26889101
Ad for Chemistry Equipment

Supplier for

Salmon calcitonin

(CAS: 47931-85-1)

Fond Chemical Co.Ltd,

Company type: Producer
Fond Chemical Co.,Ltd, headquartered in Wuxi,China, is a innovator,manufacturer and supplier of specialty chemicals serving pharmaceutical and chemical industry worldwide through a customer-driven approach. The company engage in sourcing and custom synthesis for R&D and commercial production support. The comprehensive products include Fine Chemicals, APIs, Intermediates, Cosmetic material and Lab instruments. We are seller of 1H-Pyrazolo[3,4-c]pyridine. Especially the R&D-Pilot site in Wuhan Jinggong Science & ...
Country: P.R.China   Phone: +86-510-66561189   Telefax: +86-510-66561189

Hangzhou Lingrui Chemical Co., Ltd.

Company type: Producer
Established in 2010, located in Hangzhou Qinglan science park, lingruichem is a technical company mainly focus on the Custom synthesis, manufacturing, sales of chemicals to various industries. Additionally 3-Chlorobenzotrifluoride is supplied by us. In our R&D centre, we have a staff of skilled and experienced research chemists. This has enabled us to meet the special requirements of our customers and it has enabled us to provide quality products at competitive prices. Lingrui’s credo is committed to your reliable business par ...
Country: P.R.China   Phone: +86-571-88092529   Telefax: +86-571-87334908

Arcadia Biotechnology

We are the leading company in China, to supply nutrtional supplements ingredients, APIs and it's intermediates. trans-(+/-)-11-Chloro-2,3,3a,12b-tetrahydro-2-methyl-1H-dibenz[2,3:6,7]oxepino[4,5-c]pyrrole-1-one will be also provided by us. We also provide finished product and consulting service.
Country: P.R.China   Phone: +86 21 61353236   Telefax: +86 21 61353239

Wanko Chemical Co., Ltd.

WANKO Chemical founded in 2004. We are a company specializing in the field of chemicals. We are committed to meet the demand of the global Chemical Industry, Pharmaceutical Industry and other Industrial companies. The product range includes: Building blocks, Pharmaceutical raw materials, Pharmaceutical intermediates, Chemical raw materials and Functional specialty chemicals. We provide 7-Methoxy-1-naphthaleneethanamine hydrochloride as well. We provide Custom synthesis, Contract production, Sourcing services. WANKO Chemical’s miss ...
Country: P.R.China   Phone: +86-510-83588658   Telefax: +86-510-83572192
Ad for Chemistry Equipment

Supplier for

Salmon calcitonin acetate

(CAS: 47931-85-1)

Simagchem Corporation

Company type: Bulk chemical producer
Your partner in China for chemicals business. We supply our chemical product Popcorn aroma. Expertize in supplies and sources of fine, specialty, pharmaceutical chemicals and intermediates. WE offer high quality products and JIT services with instant market intelligence in China, custom synthesis in our 3 production sites, famous principals as Brenntag, Univar,S inopec, Grace, Petrobras, DKSH, Formitex, Evonik, Merck, TCI, Sanofi, Chemo with creditable reputation and business cooperation.
Country: P.R.China   Phone: +86 592 2680 277   Telefax: +86 592 2680 237

Puyer (Nantong) BioPharma Co., Ltd.

Puyer is a Hi-Tech Company established in 2002. Our company is engaged in R&D, custom synthesis and scale-up production of Fine Chemicals, Intermediates, Amino Acids and Derivatives, Hormones, Peptide and Reagents. We have experienced team engaging in organic synthesis and have our own professional laboratory and pilot scale factory. Puyer has established strong and long term business relationships with many top companies in Europe, America and Asia-Pacific. We are supplier of Cbz-D-Tryptophan. We are never ...
Country: P.R.China   Phone: +86 513 89157626 / +86 18014398918   Telefax: +86 513 89158198
Ad for Chemistry Equipment

Supplier for


(CAS: 47931-85-1)

LGM Pharma

Company type: Supplier
Supplying the newest API’s and rarest molecules for your R&D needs. Additionally Gramicidin is supplied by us. We at LGM Pharma are leaders in supplying the worlds leading institutions with their raw materials for the research and development of the most cutting edge molecules and API’s. LGM Pharma provides our customers with full support from assistance sourcing the molecules needed for research to finding a manufacturer with the right regulatory capabilities for full product development - from the earl ...
Country: USA   Phone: +1-800-881-8210   Telefax: +1-615-250-9817
Ad for Chemistry Equipment

Salsbury Chemicals, Inc.

Company type: Manufacturer and Distributor
For many of us sourcing specialty research chemical is time consuming and daunting task. We are seller of (2S)-3-{[(tert-butoxy)carbonyl]amino}-2-{[(9H-fluoren-9-ylmethoxy)carbonyl]amino}propanoic acid. We specialize in Chemical Sourcing and procurement which can optimize your purchasing process for specialty chemical. Additionally, we will evaluate and process your custom synthesis requests to known and reliable suppliers. Benefits of Sourcing with US : • Access to resources : Access to multiple search engines along with Supplier databases.Additionally, we provide acces ...
Country: USA   Phone: +1-(800) 2471800   Telefax:
Ad for Chemistry Equipment

Supplier for

Calcitonin (salmon) Ph. Eur. (GMP)

(CAS: 47931-85-1)

Salsbury Chemicals, Inc.

Company type: Manufacturer and Distributor
For many of us sourcing specialty research chemical is time consuming and daunting task. We specialize in Chemical Sourcing and procurement which can optimize your purchasing process for specialty chemical. We sell (2S)-3-{[(tert-butoxy)carbonyl]amino}-2-{[(9H-fluoren-9-ylmethoxy)carbonyl]amino}propanoic acid as well. Additionally, we will evaluate and process your custom synthesis requests to known and reliable suppliers. Benefits of Sourcing with US : • Access to resources : Access to multiple search engines along with Supplier databases.Additionally, we provide acces ...
Country: USA   Phone: +1-(800) 2471800   Telefax:
Ad for Chemistry Equipment

Salsbury Chemicals, Inc.

Company type: Manufacturer and Distributor
For many of us sourcing specialty research chemical is time consuming and daunting task. We specialize in Chemical Sourcing and procurement which can optimize your purchasing process for specialty chemical. Additionally, we will evaluate and process your custom synthesis requests to known and reliable suppliers. (2S)-3-{[(tert-butoxy)carbonyl]amino}-2-{[(9H-fluoren-9-ylmethoxy)carbonyl]amino}propanoic acid will be also provided by us. Benefits of Sourcing with US : • Access to resources : Access to multiple search engines along with Supplier databases.Additionally, we provide acces ...
Country: USA   Phone: +1-(800) 2471800   Telefax:

english português français deutsch español
svensk norsk italiano 中国 日本語 по-русски

How do you find
new customers?

click here

Changzhou Hi-Tech Chemi
Since 1995 established, Hi-Tech has been dedicated into a set of R&D, manufacturing, CRO&CM

FEW Chemicals GmbH
Our company was founded in 1997 as FEW Forschungs- und Entwicklungsgesellschaft (R&D) Wolfen mb

Imballaggi Invernizzi S
For over 50 years, Imballaggi Invernizzi Spa has been producing industrial packaging named Fiber Dr

Melford Laboratories Lt
Melford Laboratories is an ISO9001:2008 accredited fine Chemical and Biochemical manufaturer. Our m

Zhejiang Haining Fengmi
Zhejiang Haining Fengming Chlorophyll Co., Ltd is the leading manufacturer of chlorophyll series pr

Cangzhou Enke Pharma-te
Cangzhou Enke Pharma Tech Co.,ltd. is located in Cangzhou City, Hebei province ,where is a famous p

© Copyright 1996 to 2018 by Netvertise GmbH. All rights reserved Calcitonin, Salmon