www.BuyersGuideChem.com - directory for chemicals and chemical suppliers
Productname:

BGC > Chemicals A-Z > Calcitonin, Salmon

Calcitonin, Salmon

Structure
Quick view: Suppliers
BGC Id:
564536298365
CAS No.:
Synonyms:
tz-ct | thyrocalcitonin | salmotonin | calcitoran | calcimar | salmon calcium | salcatonin | salmon | cibacalcin | salcitonin
Formula:
C145H240N44O48S2
Molecular Weight:
3431.85
EINECS:
256-342-8

List of Suppliers

Sigma-Aldrich International GmbH

Company type: Bulk and laboratory supplier
Our purpose is to solve the toughest problems in life science by collaborating with the global scientific community – and through that, we aim to accelerate access to better health for people everywhere. We provide scientists and engineers with best-in-class lab materials, technologies and services. Sigma-Aldrich International GmbH is supplier for Calcitonin, Salmon. We provide 4-Hydroxy-3-tert-Butylanisole as well. With the 2015 combination of Merck Millipore and Sigma-Aldrich, we now have a broad portfolio of 300,000 products and an expanded global footprint. We are dedica ...
Country: Switzerland   Phone: +41 81 755 28 28   Telefax: +41 81 755 28 15

Zehao Industry Co., Ltd.

The Shepherd Chemical Company was founded in Norwood, Ohio, in 1916. We are supplier of 2-(1-Methylpropyl)thiazole. We are a fourth-generation company and a custom manufacturer of Inorganic Metal Salts and Organic Metal Compounds to the global marketplace. Zehao Industry Co., Ltd. is supplier for Calcitonin, Salmon. Our long-standing success is built upon technical expertise, supplier reliability, and customer relationships. Our goal is to supply the marketplace with high quality metal compounds as standard or customized products. Our capabilities are comprised of our man ...
Country: P.R.China   Phone: +86-531-81901329   Telefax: +86-531-81901329

LGM Pharma

Company type: Supplier
Supplying the newest API’s and rarest molecules for your R&D needs. LGM Pharma is supplier for Calcitonin, Salmon. We provide Nefazodone as well. We at LGM Pharma are leaders in supplying the worlds leading institutions with their raw materials for the research and development of the most cutting edge molecules and API’s. LGM Pharma provides our customers with full support from assistance sourcing the molecules needed for research to finding a manufacturer with the right regulatory capabilities for full product development - from the earl ...
Country: USA   Phone: +1-800-881-8210   Telefax: +1-615-250-9817

Leap Labchem Co., Ltd

Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production. Leap Labchem Co., Ltd is supplier for Calcitonin, Salmon. LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities. 4-Amino-2-butanol is also served by Leap Labchem Co., Ltd. As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. Our client list includes many m ...
Country: P.R.China   Phone: +86-571-87755464   Telefax: +86-571-87756549

Santa Cruz Biotechnology, Inc.

Company type: International Supplier
Santa Cruz Biotechnology, Inc. now offers over 140,000 specialty biochemicals under our ChemCruz™ brand. rrSanta Cruz Biotechnology, Inc. is focused on the ongoing development of research reagents. Santa Cruz Biotechnology, Inc. is supplier for Calcitonin, Salmon. It is our goal to continue to offer the broadest range of reagents in the field. 3-Benzyloxybenzyl alcohol is also served by Santa Cruz Biotechnology, Inc.. We also provide superior, innovative primary antibodies and support products.rr
Country: USA   Phone: +1 800-457-3802   Telefax: +1-831-457-3802

Specification

Solubility:
0.05 M acetic acid: 1 mg/mL, clear, colorless

Safety Information

WGK Germany:
3
RTECS:
EV8000000
Storage tempuraturx:
-20°C

Most viewed

Within the past time user are also interested in the following chemicals.

Suppliers and manufactures - with identical CAS number as Calcitonin, Salmon

For the following products supplier are listed below:
    Salcatonin acetate
    Thyrocalcitonin
    Calcitonin acetate
    Salmon calcitonin
    Calcitonin
    Salmon calcitonin acetate
    Salcitonin
    Calcitonin (salmon I)
    H-[Cys-Ser-Asn-Leu-Ser-Thr-Cys]-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2
    Calcitonin (salmon) Ph. Eur. (GMP)
    Calcitonin, salmon;CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2(Disulfidebridge:1-7)


Supplier for

Salcatonin acetate

(CAS: 47931-85-1)

Chemos GmbH & Co. KG

Company type: Supplier of chemical products
Chemos is a leading supplier of chemical specialties for your research and production needs. Everything new starts small and needs specific support during scale up and production. We are supplier of 2,5-Dichloro-3-methylthiophene. With over 25 years of experience in the fine chemical market Chemos is supporting research institutions and chemical companies in Europe and America. Chemos is a sourcing and distribution company with a grown and strong network of custom manufacturing companies and chemical producers from around the ...
Country: Germany   Phone: +49-871-966346-0   Telefax: +49-871-966346-13

Skyrun Industrial Co., Ltd.

Company type: Leading producer
Skyrun Industrial Co.Limited, established in 2003, a state-controlled company (By Skyrun Corp. & High Hope) in China, specializing in developing, producing and handing raw pharmaceutical material and intermediates. Skyrun Industrial Co., Ltd. is a seller of 4,6-Dichloro-5-aminopyrimidine. We have expanded a compositive entity from initially only as a small manufacturer. We have extensive knowledge of domestic and international pharmaceutical markets. Our working range can be start from small amount in research stage to big bulk for industrial produc ...
Country: P.R.China   Phone: +86-576-84015261   Telefax: +86-576-84015261

Supplier for

Thyrocalcitonin

(CAS: 47931-85-1)

Chemos GmbH & Co. KG

Company type: Supplier of chemical products
Chemos is a leading supplier of chemical specialties for your research and production needs. We sell 2,5-Dichloro-3-methylthiophene as well. Everything new starts small and needs specific support during scale up and production. With over 25 years of experience in the fine chemical market Chemos is supporting research institutions and chemical companies in Europe and America. Chemos is a sourcing and distribution company with a grown and strong network of custom manufacturing companies and chemical producers from around the ...
Country: Germany   Phone: +49-871-966346-0   Telefax: +49-871-966346-13

Hangzhou Dayangchem Co. Ltd.

Company type: Leading producer
Hangzhou DayangChem Co. Ltd is a comprehensive entity which specializes in development, production and trade of pharmaceutical, agrochemical and dyestuff intermediates as well as some special type reagents. We have an own factory and share enterprises. We act also as agent of many chemical factories and promote their products to the international market at very competitive price. We take "Credi first, Clients supreme" as our aim. We are seller of Dilithium dodecenylsuccinate. We expect to cooperate with more partners ...
Country: P.R.China   Phone: +86-571-88938639   Telefax: +86-571-8893-8652

Supplier for

Calcitonin acetate

(CAS: 47931-85-1)

Gihi Chemicals Co., Limited

Company type: Producer
We are has expanded a compositive entity from initially only as a small manufacturer. We are seller of 6-Hydroxybenzomorpholine. The company dedicated to the development, production and marketing of chemicals. GIHI CHEMICALS covers whole range from small amount (gram grade) for research to big bulk for industrial production. Synthesis capacity from 1 liter to 5000 liter is available. GIHI CHEMICALS focus on: - Organic compounds - Active Pharmaceutical Ingredient(s) - Nutritional prod ...
Country: P.R.China   Phone: +86-571-86217390   Telefax: +86-571-86217391

Supplier for

Salmon calcitonin

(CAS: 47931-85-1)

Nebula Chemicals Co, Ltd.

Company type: Producer
Nebula Chemicals Co.,Ltd. is a medium-sized high-tech growing type private enterprise engaged in the science research, industrial production and trade service. We are supplier of 3-Bromo-2-chloropyridine. Located in Hi-tech Industries Development Zone,the company enjoys policy benefit, intensive technology, abundant resources, advantaged traffic conditions. The company has an occupied floor area of 16,500 sq. meters and a high-caliber professional team with 150 employees. The company has established own labora ...
Country: P.R.China   Phone: +86-531-55515146   Telefax: +86-531-55515146

Hangzhou Lingrui Chemical Co., Ltd.

Company type: Producer
Established in 2010, located in Hangzhou Qinglan science park, lingruichem is a technical company mainly focus on the Custom synthesis, manufacturing, sales of chemicals to various industries. In our R&D centre, we have a staff of skilled and experienced research chemists. We are seller of 4-Fluorobenzaldehyde. This has enabled us to meet the special requirements of our customers and it has enabled us to provide quality products at competitive prices. Lingrui’s credo is committed to your reliable business par ...
Country: P.R.China   Phone: +86-571-88092529   Telefax: +86-571-87334908

Arcadia Biotechnology

We are the leading company in China, to supply nutrtional supplements ingredients, APIs and it's intermediates. We also provide finished product and consulting service. Arcadia Biotechnology is a seller of 3-(4-Phenoxyphenyl)-1-(3R)-3-piperidinyl-1H-pyrazolo[3,4-d]pyrimidin-4-amine.
Country: P.R.China   Phone: +86 21 61353236   Telefax: +86 21 61353239

Hangzhou Yierdechem Co.Ltd

Company type: Sales department
With about 10 years experiences in the field of pharmaceutical intermediate and fine chemicals, Hangzhou Yierdechem has established solid business cooperation relationships with many large companys worldwide. Hangzhou Yierdechem Co.Ltd also offers 2,6-Dimethylpyridine. As a leading supplier of API and pharmaceutical intermediates, holds its principle of ”Quanlity first, customer supreme”, Yierdechem has achieved many big customer’s trust and satisfactory. And we sincerely welcome friends at home and abroad to cooperate with us fr ...
Country: P.R.China   Phone: +86-571-86904883   Telefax: +86-571-86904883

Supplier for

Calcitonin

(CAS: 47931-85-1)

Kinbester Co., Ltd.

Company type: Bulk chemical supplier
Kinbester Co., Limited is a leading technology based supplier of organic chemicals in China. Kinbester Co., Ltd. is a seller of D-Alanine amide hydrochloride. The major businesses of our company are: 1. Supply high purity organic reagent. 2. Supply intermediates for pharmaceuticals, agrochemicals, dyestuff, electro-chemicals, cosmetics, perfume etc. 3. Custom manufacturing and co-developing new chemicals under signing secret agreements. 4. Investment in fields of pharmaceuticals and intermediates ...
Country: P.R.China   Phone: +86-592-5550592   Telefax: +86-592-5550518

Ningbo Jiasi Chemical Co., Ltd.

Company type: Leading producer
Zhejiang Jiasi Chemical Co.,Ltd, approved by ISO9001:2000 is specialized in manufacturing fine chemicals.  Our company is engaged in providing fine chemicals, including pharmaceutical intermediates, alkynyl alcohols nonionic surfactant as defoaming and wetting agent, liquid crystal and electron chemicals, sensitization & photochromism materials, light initiator and special high polymer monomer etc. We are seller of Propafenone.HCl. Furthermore, we specialize in Grignard Reaction& ...
Country: P.R.China   Phone: +86-574-26889102 / 26889103 / 13967819305   Telefax: +86-574-26889101

Haihang Industry Co., Ltd.

Company type: Leading producer
Haihang Industry Co., Ltd.,is a leading producer and supplier of chemicals industry in china. We provide 1-[(2S)-3-(Acetylthio)-2-methylpropionyl]-L-proline hydrate as well. By integrating people, technology and potential, we endeavor to make contribution to the betterment of human society. We develop, produce and distribute high quality pharmaceutical chemicals, special chemicals and other fine chemicals.
Country: P.R.China   Phone: +86-531-88032799   Telefax: +86-531-85821093

Supplier for

Salmon calcitonin acetate

(CAS: 47931-85-1)

Simagchem Corporation

Company type: Bulk chemical producer
Your partner in China for chemicals business. Silver hexafluorophosphate will be also provided by us. Expertize in supplies and sources of fine, specialty, pharmaceutical chemicals and intermediates. WE offer high quality products and JIT services with instant market intelligence in China, custom synthesis in our 3 production sites, famous principals as Brenntag, Univar,S inopec, Grace, Petrobras, DKSH, Formitex, Evonik, Merck, TCI, Sanofi, Chemo with creditable reputation and business cooperation.
Country: P.R.China   Phone: +86 592 2680 277   Telefax: +86 592 2680 237

Puyer BioPharma Ltd.

Company type: Manufacturer
Puyer is a high-tech enterprise of biopharma and chemical industry founded by a group of doctors at home and abroad who work together with professional management team.The company specializes in the production, R&D and sales of APIs, intermediates, fine chemicals, nutraceuticals, crop science, animal health, CRO,CMO,CDMO and other products. Fluorescent whitening agent acf will be also provided by us. More than 300 kinds of products can be produced in batches, which are widely used in high-end fields such as medicine, chemical industry, ...
Country: P.R.China   Phone: +86 513 89157626   Telefax: +86 513 89158198

Supplier for

Salcitonin

(CAS: 47931-85-1)

LGM Pharma

Company type: Supplier
Supplying the newest API’s and rarest molecules for your R&D needs. LGM Pharma also offers Nefazodone. We at LGM Pharma are leaders in supplying the worlds leading institutions with their raw materials for the research and development of the most cutting edge molecules and API’s. LGM Pharma provides our customers with full support from assistance sourcing the molecules needed for research to finding a manufacturer with the right regulatory capabilities for full product development - from the earl ...
Country: USA   Phone: +1-800-881-8210   Telefax: +1-615-250-9817

Supplier for

Calcitonin (salmon I)

(CAS: 47931-85-1)

Bachem AG

Company type: Leading producer
About Bachem Bachem is a listed technology-based company focused on peptide chemistry. The company provides a full range of services to the pharma and biotech industries. It specializes in the development of innovative, efficient manufacturing processes and the reliable production of peptide-based active pharmaceutical ingredients. A comprehensive catalog of biochemicals and exclusive custom syntheses for research labs complete the service portfolio. Bachem AG also offers H-Pro-His-Gly-OH. Headquartered in Swi ...
Country: Switzerland   Phone: +41 58 595 2021   Telefax: +41 58 595 2040

Salsbury Chemicals, Inc.

Company type: Manufacturer and Distributor
For many of us sourcing specialty research chemical is time consuming and daunting task. We specialize in Chemical Sourcing and procurement which can optimize your purchasing process for specialty chemical. Additionally, we will evaluate and process your custom synthesis requests to known and reliable suppliers. We are supplier of 2,6-Diphenylcyclohexan-1-one. Benefits of Sourcing with US : • Access to resources : Access to multiple search engines along with Supplier databases.Additionally, we provide acces ...
Country: USA   Phone: +1-(800) 2471800   Telefax:

Supplier for

Calcitonin (salmon) Ph. Eur. (GMP)

(CAS: 47931-85-1)

Salsbury Chemicals, Inc.

Company type: Manufacturer and Distributor
For many of us sourcing specialty research chemical is time consuming and daunting task. We are seller of 2,6-Diphenylcyclohexan-1-one. We specialize in Chemical Sourcing and procurement which can optimize your purchasing process for specialty chemical. Additionally, we will evaluate and process your custom synthesis requests to known and reliable suppliers. Benefits of Sourcing with US : • Access to resources : Access to multiple search engines along with Supplier databases.Additionally, we provide acces ...
Country: USA   Phone: +1-(800) 2471800   Telefax:

Salsbury Chemicals, Inc.

Company type: Manufacturer and Distributor
For many of us sourcing specialty research chemical is time consuming and daunting task. We specialize in Chemical Sourcing and procurement which can optimize your purchasing process for specialty chemical. We sell 2,6-Diphenylcyclohexan-1-one as well. Additionally, we will evaluate and process your custom synthesis requests to known and reliable suppliers. Benefits of Sourcing with US : • Access to resources : Access to multiple search engines along with Supplier databases.Additionally, we provide acces ...
Country: USA   Phone: +1-(800) 2471800   Telefax:


Related products:


Language:
english português français deutsch español
svensk norsk italiano 中国 日本語 по-русски




How do you find
new customers?

click here


Jiangsu Tetra New Mater
Tetrachem is a high-tech company specialized in R&D, production, sales and technical service of


Rech Chemical Co., Ltd.
Twenties years ago, Rech Chemical Co.,Ltd were mainly a solid manganese sulphate supplier. Today, b


Codexis, Inc.
Is a world leader in providing unique, state-of-the-art enzyme optimization services and developing


Klong Industrial Co., L
Klong Industrial Co., Ltd as the owner of Changzhou Redis-Tech Chemical Co.,Ltd was established sin


Shanghai Juyuan Flame R
Shanghai Juyuan Flame-Retardant Material Co., Ltd is an enterprise professionally producing and man


Shenzhen JYMed Technolo
Shenzhen JYMed Technology Co., Ltd is a high-tech enterprise specializing in R&D, manufacture a


© Copyright 1996 to 2019 by Netvertise GmbH. All rights reserved Calcitonin, Salmon