pTH (1-34) (human)

BGC Id:	421632583890
CAS No:	52232-67-4
Synonyms:	[cys5,28] pth (1-34), human ; pth(1-34)(human) acetate ; pth (1-34) (human) ; pth (human, 1-34) ; m.w. 4117.72 c181h291n55o51s2 ; parathyroid hormone (1-34), human ; teriparatide ; parathormone (1-34) ; (1-34)-human parathyroid hormone ; teriparatide acetate
Molecular Formula:	C181H291N55O51S2
Molecular Weight:	3890.49792
EINECS:

The most competitive supplier in 2025

The following notable provider has been checked and can be recommended.

BuGuCh & Partners

type bedrift: Producer

land: Germany

We, BuGuCh & Partners, are an international acting and innovative company, leading in developing and manufacturing. We operates major facilities in North America, Europe and the Pacific Rim, as well as facilities in China, Japan and Saudi Arabia operated through joint ventures. We maintain independently or are partners of some production site ...

INQUIRY | ORDER

What other providers are available for CAS 52232-67-4?

The last intensive check and update was carried out on 2025/05/30.

Identify

Synonyms:

[cys5,28] pth (1-34), human ; pth(1-34)(human) acetate ; pth (1-34) (human) ; pth (human, 1-34) ; m.w. 4117.72 c181h291n55o51s2 ; parathyroid hormone (1-34), human ; teriparatide ; parathormone (1-34) ; (1-34)-human parathyroid hormone ; teriparatide acetate

CAS:

52232-67-4

EINECS:

Molecular Formula:

C181H291N55O51S2

MDL:

Properties

Molecular Weight:

3890.49792 g·mol−1

Safety Information

Hazard Classes:

WGK Germany:

Storage temperature:

-20°C

The following providers cannot be verified precisely. The companies have offered the product in the past, but despite all care, the companies could not confirm it 100 percent!

Bachem AG

About Bachem Bachem is a listed technology-based company focused on peptide chemistry. The company provides a full range of services to the pharma an... Request

What other providers are available for CAS 52232-67-4?

In addition to the providers presented here for pTH (1-34) (human) with the CAS number 52232-67-4, there are other 77 providers with slightly different product names available for this CAS number.

Teriparatide

Zyntex Ltd | FUDAW INDUSTRY LTD | Shandong Ench Chemical Co.,Ltd | Hangzhou Meite Industry Co., Ltd (Hangzhou Meite Chemical Co., Ltd) | Nantong Xindao Biotech Ltd +15 additional providers that we know from the past

Teriparatide acetate

Teriparatide D10 Acetate

+1 additional providers that we know from the past

Parathyroid hormone(1-34) human

BuGuCh & Partners +2 additional providers that we know from the past

pTH (1-34) (human) Acetate (GMP)

+1 additional providers that we know from the past

Parathyroid Hormone (1-34), human;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

+2 additional providers that we know from the past

H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH

+2 additional providers that we know from the past