Chemical-Suppliers
The independent directory of chemicals and chemical suppliers and producers.
BuyersGuideChem
BGC » Chemicals A-Z » Calcitonin (eel)
pr

Calcitonin (eel)

BGC Id:691615252931
CAS No:57014-02-5
Synonyms:miacalcic ; thyrocalcitonin eel ; eel calcitonin ; asu 1-7 ; calcitonin (eel) (9ci) ; eel thyrocalcitonin ; h-cys-ser-asn-leu-ser-thr-cys-val-leu-gly-lys-leu-ser-gln-glu-leu-his-lys-leu-gln-thr-tyr-pro-arg-thr-asp-val-gly-ala-gly-thr-pro-nh2 ; csnlstcvlgklsqelhklqtyprtdvgagtp-nh2 ; calcitonin, eel ; csnlstcvlgklsqelhklqtyprtdvgagtp-nh2 (disulfide bridge: 1-7)
Molecular Formula:C146H243N43O47S2
Molecular Weight:3414.87
EINECS:
Structural Formula

2025 - The most valued supplier

The following 5 notable providers have been checked and can be recommended.
Chemical-Suppliers
BOC Sciences
Description : Calcitonin eel is a peptide hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of nonmammalian vertebrates.
  • Molecular Weight :3414.86
  • Purity :98%
Molecular Formula : C146H241N43O47S2 Canonical SMILES : CC(C)CC1C(=O)NC(C(=O)NC(C(=O)NC(CSSCC(C(=O)NC(C(=O)NC(C(=O)N1)CC(=O)N)CO)N)C(=O)NC(C(C)C)C(=O)NC(CC(C)C)C(=O)NCC(=O)NC(CCCCN)C(=O)NC(CC(C)C)C(=O)NC(CO)C(=O)NC(CCC(=O)N)C(=O)NC( >>more

Chemical-Suppliers
Leap Chem
Molecular Formula: C146H241N43O47S2 Molecular Weight: 3414.87 WGKGermany: 3

The last intensive check and update was carried out on 2025/05/30.

Identify

Synonyms:
miacalcic ; thyrocalcitonin eel ; eel calcitonin ; asu 1-7 ; calcitonin (eel) (9ci) ; eel thyrocalcitonin ; h-cys-ser-asn-leu-ser-thr-cys-val-leu-gly-lys-leu-ser-gln-glu-leu-his-lys-leu-gln-thr-tyr-pro-arg-thr-asp-val-gly-ala-gly-thr-pro-nh2 ; csnlstcvlgklsqelhklqtyprtdvgagtp-nh2 ; calcitonin, eel ; csnlstcvlgklsqelhklqtyprtdvgagtp-nh2 (disulfide bridge: 1-7)
CAS:
57014-02-5
EINECS:
Molecular Formula:
C146H243N43O47S2
MDL:

Properties

Molecular Weight:
3414.87 g·mol−1

Suppliers

Lori Industry Co., Ltd

type bedrift: Bulk chemical producer
Lori industry Co., Ltd was established in 2002 years. It is a large-scale manufacturer integrating R&D, produce and sales. Vi er selger av alpha-Terpinene. Our products mainly cover fine chemicals, organic intermediates, biological buffers, agricultural fertilizers and other chemicals . Among them, the sales proportion of organic chemicals and agricultural fertilizers is at the forefront of the domestic market. From 2013 to 2022 years, through cooperation with foreign trade companies, customers visitation, ...
land: P.R.China   telefon: +86-13011713125   Fax: +86-13011713125

BOC Sciences

type bedrift: Supplier
land: USA
telefon: +1-631-485-4226
Fax: +1-631-614-7828
BOC Sciences provides a wide range of customer services, bulk and specialty compounds to the pharmaceutical, agrochemical and biotechnology industries. We intend to offer you the products and services of the highest quality at the most reasonable, cost efficient prices. Vi selger FK-866 også. Most of our compounds can be supplied ranging from mg to kg and arrive with analytic report. We hope to add immense value to your research projects!

Hangzhou Lingrui Chemical Co., Ltd.

Established in 2010, located in Hangzhou Qinglan science park, lingruichem is a technical company mainly focus on the Custom synthesis, manufacturing, sales of chemicals to various industries. In our R&D centre, we have a staff of skilled and experienced research chemists. This has enabled us to meet the special requirements of our customers and it has enabled us to provide quality products at competitive prices. Lingrui’s credo is committed to your reliable business partne ...
type bedrift: Producer
land: P.R.China
telefon: +86-571-88092529
Fax: +86-571-87334908

Leap Chem Co., Ltd

type bedrift: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production. LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities. As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. Our client list includes many major pharmac ...
land: P.R.China   telefon: +852-30606658  

BuGuCh & Partners

type bedrift: Producer
land: Germany
We, BuGuCh & Partners, are an international acting and innovative company, leading in developing and manufacturing. We operates major facilities in North America, Europe and the Pacific Rim, as well as facilities in China, Japan and Saudi Arabia operated through joint ventures. We maintain independently or are partners of some production sites in Europe, Asia and South America. Our global network is a strength. Our products range from natural gas, oil and basic chemi ...

Safety Information

Hazard Classes:
WGK Germany:
3
Storage temperature:
-20°C

What other providers are available for CAS 57014-02-5?

In addition to the providers presented here for Calcitonin (eel) with the CAS number 57014-02-5, there are other 11 providers with slightly different product names available for this CAS number.

+1 additional providers that we know from the past
Simagchem Corporation | BIOZOL Diagnostica Vertrieb GmbH +4 additional providers that we know from the past
+2 additional providers that we know from the past
+2 additional providers that we know from the past




Chemical-Suppliers
© Copyright 1996 to 2025 by Netvertise GmbH. All rights reserved. Reproduction of any materials from the site is strictly forbidden without permission.