BGC » Chemicals A-Z » Aviptadil acetate

Identify Suppliers 2025 Properties Safty ☰

Identify Suppliers 2025 Properties Safty

Aviptadil acetate

BGC Id:	353078451376
CAS No:	40077-57-4
Synonyms:	urotensin-ii, mouse ; vipã€rabbitã€‘ ; vipã€pigã€‘ ; aviptadil acetate ; vip ; vip (28 amino acids) ; aviptadil ; vip (human, porcine) ; metformin glycinate ; vip porcine
Molecular Formula:	C147H238N44O42S
Molecular Weight:	3325.8
EINECS:

Verified providers in 2025

The following 4 notable providers have been checked and can be recommended.

Simagchem

Amadis Chemical Company

Xingrui Industry

Xiamen Equation Chemical

What other providers are available for CAS 40077-57-4?

The last intensive check and update was carried out on 2025/04/08.

Identify

Synonyms:

urotensin-ii, mouse ; vipã€rabbitã€‘ ; vipã€pigã€‘ ; aviptadil acetate ; vip ; vip (28 amino acids) ; aviptadil ; vip (human, porcine) ; metformin glycinate ; vip porcine

CAS:

40077-57-4

EINECS:

Molecular Formula:

C147H238N44O42S

MDL:

Properties

Molecular Weight:

3325.8 g·mol−1

Suppliers

Simagchem Corporation

type bedrift: Bulk chemical producer

Your partner in China for chemicals business. 4,4'-(bis-(9-Ethyl-3-carbazovinylene)-1,1'-biphenyl er også tjent med Simagchem Corporation. Expertize in supplies and sources of fine, specialty, pharmaceutical chemicals and intermediates. WE offer high quality products and JIT services with instant market intelligence in China, custom synthesis in our 3 production sites, famous principals as Brenntag, Univar,S inopec, Grace, Petrobras, DKSH, Formitex, Evonik, Merck, TCI, Sanofi, Chemo with creditable reputation and business cooperation.

land: P.R.China telefon: +86 592 2680 277 Fax: +86 592 2680 237

INQUIRY | ORDER

» contact details

Amadis Chemical Company Limited

type bedrift: Leading producer

land: P.R.China
telefon: +86-571-89925085
Fax: +86-571-89925065

Amadis Chemical is one of the leading enterprises in medical and health products research,development,manufacture and trading.rnEstablished in 2010, Amadis Chemical are adhering to the " Consummate service Convincing honor " Business strategy. Vi er leverandør av Sbfi-26. The topping products and service we providing to you base on our strong technical accumulation and outstanding professional quality.rnOur associated labs, leading by the outstanding chemistry or pharmacy professors ,make us keep ahead a ...

INQUIRY | ORDER

» contact details

Xingrui Industry Co., Limited

Xingrui Industry CO., LTD. Zinc phenylphosphonate er også tjent med Xingrui Industry Co., Limited. is a professional manufacturing enterprise integrating R&D, production and sales. The products involved fine chemicals, pharmaceutical intermediates, dye intermediates, cosmetic raw materials and so on. The company is ranked among the outstanding producers in the fine chemical industry. Xingrui Industry always strive to be the most reliable partner of our customers, and strive to build a customer-trusted, socially respected, world-class fine chemi ...

type bedrift: Leading producer

land: P.R.China
telefon: +86-531-88980365
Fax: +86-531-88980365

INQUIRY | ORDER

» contact details

Xiamen Equation Chemical Co.,Ltd

type bedrift: Bulk chemical producer

Welcome to Equation chemical, your reliable partner in China as an important supplier of bulk specialty chemicals for industry & life science. We are committed to provide experienced high quality product and JIT performance to benefit our customers.

land: P.R.China telefon: +86 592 6515854 Fax: +86 592 6515854

INQUIRY | ORDER

» contact details

Safety Information

Hazard Classes:

WGK Germany:

Storage temperature:

-20°C

What other providers are available for CAS 40077-57-4?

In addition to the providers presented here for Aviptadil acetate with the CAS number 40077-57-4, there are other 28 providers with slightly different product names available for this CAS number.

Aviptadil

Finetech Industry Limited | Nantong Xindao Biotech Ltd | BOC Sciences | Leap Chem Co., Ltd +8 additional providers that we know from the past

Aviptadil (GMP)

+1 additional providers that we know from the past

VIP (human, mouse, rat)

+1 additional providers that we know from the past

Vasoactive Intestinal Peptide

Lori Industry Co., Ltd +1 additional providers that we know from the past

VIP (human, bovine, porcine, rat)

Leap Chem Co., Ltd +5 additional providers that we know from the past

Vasoactive intestinaloctacosapeptide (swine)

Hangzhou Zhongqi Chem Co., Ltd

VIP, human, porcine, rat;HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2

+2 additional providers that we know from the past

H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2

+3 additional providers that we know from the past