Chemical-Suppliers
The independent directory of chemicals and chemical suppliers and producers.
BuyersGuideChem
BGC » Chemicals A-Z » Peptide YY, human
pr

Peptide YY, human

BGC Id:595246816588
CAS No:118997-30-1
Synonyms:peptide tyrosine tyrosine, human ; peptide yy (human) acetate ; l-tyrosinamide, l-tyrosyl-l-prolyl-l-isoleucyl-l-lysyl-l-prolyl-l-α-glutamyl-l-alanyl-l-prolylglycyl-l-α-glutamyl-l-α-aspartyl-l-alanyl-l-seryl-l-prolyl-l-α-glutamyl-l-α-glutamyl-l-leucyl-l-asparaginyl-l-arginyl-l-tyrosyl-l-tyrosyl-l-alanyl-l-seryl-l-leucyl-l-arginyl-l-histidyl-l-tyrosyl-l-leucyl-l-asparaginyl-l-leucyl-l-valyl-l-threonyl-l-arginyl-l-glutaminyl-l-arginyl- ; ypikpeapgedaspeelnryyaslrhylnlvtrqry-nh2 ; tyr-pro-ile-lys-pro-glu-ala-pro-gly-glu-asp-ala-ser-pro-glu-glu-leu-asn-arg-tyr-tyr-ala-ser-leu-arg-his-tyr-leu-asn-leu-val-thr-arg-gln-arg-tyr-nh2 ; peptide yy, human ; human peptide yy ; peptide yy (human)|peptide yy, pyy, human ; pyy (human) ; m.w. 4309.75 c194h295n55o57 ; peptide yy pyy human
Molecular Formula:C194H295N55O57
Molecular Weight:4309.75
EINECS:
Structural Formula

Verified providers in 2025

The following 2 notable providers have been checked and can be recommended.
Chemical-Suppliers
Leap Chem
Molecular Formula: C194H295N55O57 Molecular Weight: 4309.7524 WGKGermany: 3

The last intensive check and update was carried out on 2025/07/31.

Identify

Synonyms:
peptide tyrosine tyrosine, human ; peptide yy (human) acetate ; l-tyrosinamide, l-tyrosyl-l-prolyl-l-isoleucyl-l-lysyl-l-prolyl-l-α-glutamyl-l-alanyl-l-prolylglycyl-l-α-glutamyl-l-α-aspartyl-l-alanyl-l-seryl-l-prolyl-l-α-glutamyl-l-α-glutamyl-l-leucyl-l-asparaginyl-l-arginyl-l-tyrosyl-l-tyrosyl-l-alanyl-l-seryl-l-leucyl-l-arginyl-l-histidyl-l-tyrosyl-l-leucyl-l-asparaginyl-l-leucyl-l-valyl-l-threonyl-l-arginyl-l-glutaminyl-l-arginyl- ; ypikpeapgedaspeelnryyaslrhylnlvtrqry-nh2 ; tyr-pro-ile-lys-pro-glu-ala-pro-gly-glu-asp-ala-ser-pro-glu-glu-leu-asn-arg-tyr-tyr-ala-ser-leu-arg-his-tyr-leu-asn-leu-val-thr-arg-gln-arg-tyr-nh2 ; peptide yy, human ; human peptide yy ; peptide yy (human)|peptide yy, pyy, human ; pyy (human) ; m.w. 4309.75 c194h295n55o57 ; peptide yy pyy human
CAS:
118997-30-1
EINECS:
Molecular Formula:
C194H295N55O57
MDL:

Properties

Molecular Weight:
4309.75 g·mol−1

Suppliers

Skyrun Industrial Co., Ltd.

Type de compagnie: Leading producer
Skyrun Industrial Co.Limited, established in 2003, a state-controlled company (By Skyrun Corp. & High Hope) in China, specializing in developing, producing and handing raw pharmaceutical material and intermediates. Nous vendons Scandium(III) chloride hydrate ainsi. We have expanded a compositive entity from initially only as a small manufacturer. We have extensive knowledge of domestic and international pharmaceutical markets. Our working range can be start from small amount in research stage to big bulk for industrial produc ...
pays: P.R.China   phone: +86-576-84015261   fax: +86-576-84015261

Leap Chem Co., Ltd

Type de compagnie: Bulk and laboratory supplier
pays: P.R.China
phone: +852-30606658
LEAPChem, a specialized fine chemicals supplier for research, development and production. LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities. As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. Our client list includes many major pharmac ...

Safety Information

Hazard Classes:
WGK Germany:
3
Storage temperature:
-20°C

What other providers are available for CAS 118997-30-1?

In addition to the providers presented here for Peptide YY, human with the CAS number 118997-30-1, there are other 14 providers with slightly different product names available for this CAS number.

BuGuCh & Partners +6 additional providers that we know from the past
+1 additional providers that we know from the past
+2 additional providers that we know from the past
+2 additional providers that we know from the past
+2 additional providers that we know from the past




Chemical-Suppliers
© Copyright 1996 to 2025 by Netvertise GmbH. All rights reserved. Reproduction of any materials from the site is strictly forbidden without permission.