Chemical-Suppliers
The independent directory of chemicals and chemical suppliers and producers.
BuyersGuideChem
BGC » Chemicals A-Z » Charybdotoxin
pr

Charybdotoxin

BGC Id:961613855527
CAS No:95751-30-7
Synonyms:charybdotoxin (reduced),cyclic (7® ; charybdotoxin chtx ; charybdotoxin, recombinant, e coli ; m.w. 4295.89 c176h277n57o55s7 ; rchtx ; 33),(17® ; charybdotoxin ; 33,34,70,71,95,96-hexathia-2,5,8,11,14,17,20,23,26,29,37,40,43,46,49,52,55,58,61,64,67,74,77,80,83,86,89,92-octacosaazatricyclo[34.32.25.413,79]heptanonacontane,cyclic peptide deriv. ; 36: pn: wo2006116156 seqid: 36 claimed protein ; 35)-tris(disulfide) ; rcharybdotoxin ; chtx ; charybdotoxin, recombinant ; charybdotoxin, leiurus quinquestriatus hebraeus ; charybdotoxin (leiurus quinquestriatus hebraeus) ; 28),(13® ; pyr-ftnvscttskecwsvcqrlhntsrgkcmnkkcrcys
Molecular Formula:C176H277 N57 O55 S7
Molecular Weight:4295.89
EINECS:
Structural Formula
Les fournisseurs 5 sont fiables et fiables pour Charybdotoxin. Ils viennent des pays 3 à travers le monde. Ces fournisseurs appartiennent à 5 différents types d'affaires comme 'Leading producer' et 'Supplier'
Veuillez contacter tous les distributeurs / fabricants ci-dessous pour Charybdotoxin et demander des prix, des normes d'emballage et des possibilités de transport. Nos distributeurs enregistrés vous aideront à obtenir toutes les informations nécessaires et les spécifications du produit.


supplier ww
Fournisseurs enregistrés de Charybdotoxin dans le monde entier

2025 - The most valued supplier

The following 5 notable providers have been checked and can be recommended.
Chemical-Suppliers
BOC Sciences
Description : Charybdotoxin is a Ca2+-activated K+ channel blocker used as an ADC Cytotoxin.
  • Molecular Weight :4295.88
  • Purity :95%
Molecular Formula : C176H277N57O55S7 Canonical SMILES : CC(C)CC1C(=O)NC(C(=O)NC(C(=O)NC(C(=O)NC(C(=O)NC(C(=O)NCC(=O)NC(C(=O)NC2CSSCC(C(=O)NC(C(=O)NC(C(=O)NC(C(=O)NC(C(=O)NC(C(=O)NC3CSSCC(C(=O)NC(C(=O)NC(CSSCC(C(=O)NC(C(=O)NC(C(=O)N1)CCCNC(=N)N)CCC(=O)N)NC(=O)C(NC(=O)C(NC(=O)C(NC3=O)CC4=CNC5=CC=CC=C54)CO) >>more
Chemical-Suppliers
Leap Chem
Molecular Formula: C176H277N57O55S7 Molecular Weight: 4295.89 WGKGermany: 3

The last intensive check and update was carried out on 2025/05/30.

Identify

Synonyms:
charybdotoxin (reduced),cyclic (7® ; charybdotoxin chtx ; charybdotoxin, recombinant, e coli ; m.w. 4295.89 c176h277n57o55s7 ; rchtx ; 33),(17® ; charybdotoxin ; 33,34,70,71,95,96-hexathia-2,5,8,11,14,17,20,23,26,29,37,40,43,46,49,52,55,58,61,64,67,74,77,80,83,86,89,92-octacosaazatricyclo[34.32.25.413,79]heptanonacontane,cyclic peptide deriv. ; 36: pn: wo2006116156 seqid: 36 claimed protein ; 35)-tris(disulfide) ; rcharybdotoxin ; chtx ; charybdotoxin, recombinant ; charybdotoxin, leiurus quinquestriatus hebraeus ; charybdotoxin (leiurus quinquestriatus hebraeus) ; 28),(13® ; pyr-ftnvscttskecwsvcqrlhntsrgkcmnkkcrcys
CAS:
95751-30-7
EINECS:
Molecular Formula:
C176H277 N57 O55 S7
MDL:
MFCD00146378
SMILES:
O=P(C1=CC=CC=C1)C1=CC=CC=C1

Properties

Molecular Weight:
4295.89 g·mol−1
Solubility:
Solution at 1 mg/ml in Water
Physical Description:
white powder
download Download Molfile

Suppliers

Dayang Chem (Hangzhou) Co.,Ltd.

Type de compagnie: Leading producer
Hangzhou DayangChem Co. Ltd is a comprehensive entity which specializes in development, production and trade of pharmaceutical, agrochemical and dyestuff intermediates as well as some special type reagents. We have an own factory and share enterprises. We act also as agent of many chemical factories and promote their products to the international market at very competitive price. We take "Credi first, Clients supreme" as our aim. Nous vendons Picrotin ainsi. We expect to cooperate with more partners in ...
pays: P.R.China   phone: +86-571-88938639   fax: +86-571-8893-8652

BOC Sciences

Type de compagnie: Supplier
pays: USA
phone: +1-631-485-4226
fax: +1-631-614-7828
BOC Sciences provides a wide range of customer services, bulk and specialty compounds to the pharmaceutical, agrochemical and biotechnology industries. We intend to offer you the products and services of the highest quality at the most reasonable, cost efficient prices. Most of our compounds can be supplied ranging from mg to kg and arrive with analytic report. BOC Sciences offre également Osimertinib D6. We hope to add immense value to your research projects!

Leap Chem Co., Ltd

LEAPChem, a specialized fine chemicals supplier for research, development and production. LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities. As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. Our client list includes many major pharmac ...
Type de compagnie: Bulk and laboratory supplier
pays: P.R.China
phone: +852-30606658

BIOZOL Diagnostica Vertrieb GmbH

Type de compagnie: Supplier of chemical products
Chemos®, a subsidiary of BIOZOL Diagnostica Vertrieb GmbH, is a leading supplier of ready to use solutions for the lab and chemical industry. We are producing reagents and standards for the analytical lab and supplying raw materials for the chemical and pharmaceutical industry. En outre 4,5-Dichloroisothiazole-3-carboxylic acid est fourni par nous. The base of our solutions are a portfolio of ~ 200.000 raw materials where ~ 50.000 are already available for R+D ready to order in our shop. We are supplying and producing lab quantities from tiny qua ...
pays: Germany   phone: +49-871-966346-0   fax: +49-871-966346-13

BuGuCh & Partners

Type de compagnie: Producer
pays: Germany
We, BuGuCh & Partners, are an international acting and innovative company, leading in developing and manufacturing. We operates major facilities in North America, Europe and the Pacific Rim, as well as facilities in China, Japan and Saudi Arabia operated through joint ventures. We maintain independently or are partners of some production sites in Europe, Asia and South America. Our global network is a strength. Our products range from natural gas, oil and basic chemi ...

Safety Information

Hazard Classes:
WGK Germany:
3
Storage temperature:
-20°C

What other providers are available for CAS 95751-30-7?

In addition to the providers presented here for Charybdotoxin with the CAS number 95751-30-7, there are other 6 providers with slightly different product names available for this CAS number.

+2 additional providers that we know from the past
+2 additional providers that we know from the past
+2 additional providers that we know from the past




Chemical-Suppliers
© Copyright 1996 to 2025 by Netvertise GmbH. All rights reserved. Reproduction of any materials from the site is strictly forbidden without permission.