Chemical-Suppliers
The independent directory of chemicals and chemical suppliers and producers.
BuyersGuideChem
BGC » Chemicals A-Z » Cecropin A
pr

Cecropin A

BGC Id:261618154917
CAS No:80451-04-3
Synonyms:kwklfkkiekvgqnirdgiikagpavavvgqatqiak-nh2 ; h-lys-trp-lys-leu-phe-lys-lys-ile-glu-lys-val-gly-gln-asn-ile-arg-asp-gly-ile-ile-lys-ala-gly-pro-ala-val-ala-val-val-gly-gln-ala-thr-gln-ile-ala-lys-nh2 ; 2: pn: wo2009033815 page:103 claimed protein ; hyalophora cecropin a ; cecropina (platysamia cecropia antibacterial peptide) (9ci) ; l-lysinamide,l-lysyl-l-tryptophyl-l-lysyl-l-leucyl-l-phenylalanyl-l-lysyl-l-lysyl-l-isoleucyl-l-a-glutamyl-l-lysyl-l-valylglycyl-l-glutaminyl-l-asparaginyl-l-isoleucyl-l-arginyl-l-a-aspartylglycyl-l-isoleucyl-l-isoleucyl-l-lysyl-l-alanylglycyl-l-prolyl-l-alanyl-l-valyl-l-alanyl-l-valyl-l-valylglycyl-l-glutaminyl-l-alanyl-l-threonyl-l-glutaminyl-l-isoleucyl-l-alanyl- ; cecropin a, porcine ; cecropin a
Molecular Formula:C184H313 N53 O46
Molecular Weight:4003.78
EINECS:
Structural Formula

2025 - The most valued supplier

The following 3 notable providers have been checked and can be recommended.
Chemical-Suppliers
Leap Chem
Molecular Formula: C184H313N53O46 Molecular Weight: 4003.78152 WGKGermany: 3

The last intensive check and update was carried out on 2025/05/30.

Identify

Synonyms:
kwklfkkiekvgqnirdgiikagpavavvgqatqiak-nh2 ; h-lys-trp-lys-leu-phe-lys-lys-ile-glu-lys-val-gly-gln-asn-ile-arg-asp-gly-ile-ile-lys-ala-gly-pro-ala-val-ala-val-val-gly-gln-ala-thr-gln-ile-ala-lys-nh2 ; 2: pn: wo2009033815 page:103 claimed protein ; hyalophora cecropin a ; cecropina (platysamia cecropia antibacterial peptide) (9ci) ; l-lysinamide,l-lysyl-l-tryptophyl-l-lysyl-l-leucyl-l-phenylalanyl-l-lysyl-l-lysyl-l-isoleucyl-l-a-glutamyl-l-lysyl-l-valylglycyl-l-glutaminyl-l-asparaginyl-l-isoleucyl-l-arginyl-l-a-aspartylglycyl-l-isoleucyl-l-isoleucyl-l-lysyl-l-alanylglycyl-l-prolyl-l-alanyl-l-valyl-l-alanyl-l-valyl-l-valylglycyl-l-glutaminyl-l-alanyl-l-threonyl-l-glutaminyl-l-isoleucyl-l-alanyl- ; cecropin a, porcine ; cecropin a
CAS:
80451-04-3
EINECS:
Molecular Formula:
C184H313 N53 O46
MDL:
MFCD00130752

Properties

Molecular Weight:
4003.78 g·mol−1

Suppliers

Leap Chem Co., Ltd

Type de compagnie: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production. LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities. As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. Our client list includes many major pharmac ...
pays: P.R.China   phone: +852-30606658  

BIOZOL Diagnostica Vertrieb GmbH

Type de compagnie: Supplier of chemical products
pays: Germany
phone: +49-871-966346-0
fax: +49-871-966346-13
Chemos®, a subsidiary of BIOZOL Diagnostica Vertrieb GmbH, is a leading supplier of ready to use solutions for the lab and chemical industry. We are producing reagents and standards for the analytical lab and supplying raw materials for the chemical and pharmaceutical industry. The base of our solutions are a portfolio of ~ 200.000 raw materials where ~ 50.000 are already available for R+D ready to order in our shop. Nous sommes fournisseur de Butane-1,1,4,4,-tetrol. We are supplying and producing lab quantities from tiny qua ...

BuGuCh & Partners

We, BuGuCh & Partners, are an international acting and innovative company, leading in developing and manufacturing. We operates major facilities in North America, Europe and the Pacific Rim, as well as facilities in China, Japan and Saudi Arabia operated through joint ventures. We maintain independently or are partners of some production sites in Europe, Asia and South America. Our global network is a strength. Our products range from natural gas, oil and basic chemi ...
Type de compagnie: Producer
pays: Germany

Safety Information

Hazard Classes:
WGK Germany:
3
Storage temperature:
-20°C

What other providers are available for CAS 80451-04-3?

In addition to the providers presented here for Cecropin A with the CAS number 80451-04-3, there are other 2 providers with slightly different product names available for this CAS number.

+2 additional providers that we know from the past




Chemical-Suppliers
© Copyright 1996 to 2025 by Netvertise GmbH. All rights reserved. Reproduction of any materials from the site is strictly forbidden without permission.