Chemical-Suppliers
The independent directory of chemicals and chemical suppliers and producers.
BuyersGuideChem
BGC » Chemicals A-Z » Peptide YY (human)
pr

Peptide YY (human)

BGC Id:301637527698
CAS No:118997-30-1
Synonyms:peptide yy pyy human ; l-tyrosinamide, l-tyrosyl-l-prolyl-l-isoleucyl-l-lysyl-l-prolyl-l-α-glutamyl-l-alanyl-l-prolylglycyl-l-α-glutamyl-l-α-aspartyl-l-alanyl-l-seryl-l-prolyl-l-α-glutamyl-l-α-glutamyl-l-leucyl-l-asparaginyl-l-arginyl-l-tyrosyl-l-tyrosyl-l-alanyl-l-seryl-l-leucyl-l-arginyl-l-histidyl-l-tyrosyl-l-leucyl-l-asparaginyl-l-leucyl-l-valyl-l-threonyl-l-arginyl-l-glutaminyl-l-arginyl- ; peptide tyrosine tyrosine, human ; tyr-pro-ile-lys-pro-glu-ala-pro-gly-glu-asp-ala-ser-pro-glu-glu-leu-asn-arg-tyr-tyr-ala-ser-leu-arg-his-tyr-leu-asn-leu-val-thr-arg-gln-arg-tyr-nh2 ; peptide yy (human) acetate ; pyy (human) ; human peptide yy ; m.w. 4309.75 c194h295n55o57 ; peptide yy, human ; peptide yy (human)|peptide yy, pyy, human ; ypikpeapgedaspeelnryyaslrhylnlvtrqry-nh2
Molecular Formula:C194H295N55O57
Molecular Weight:4309.75
EINECS:
Structural Formula

The most competitive supplier in 2025

The following notable provider has been checked and can be recommended.
Chemical-Suppliers
BuGuCh & Partners
Tipo de companhia: Producer
país: Germany
We, BuGuCh & Partners, are an international acting and innovative company, leading in developing and manufacturing. We operates major facilities in North America, Europe and the Pacific Rim, as well as facilities in China, Japan and Saudi Arabia operated through joint ventures. We maintain independently or are partners of some production site ...
The last intensive check and update was carried out on 2025/05/30.

Identify

Synonyms:
peptide yy pyy human ; l-tyrosinamide, l-tyrosyl-l-prolyl-l-isoleucyl-l-lysyl-l-prolyl-l-α-glutamyl-l-alanyl-l-prolylglycyl-l-α-glutamyl-l-α-aspartyl-l-alanyl-l-seryl-l-prolyl-l-α-glutamyl-l-α-glutamyl-l-leucyl-l-asparaginyl-l-arginyl-l-tyrosyl-l-tyrosyl-l-alanyl-l-seryl-l-leucyl-l-arginyl-l-histidyl-l-tyrosyl-l-leucyl-l-asparaginyl-l-leucyl-l-valyl-l-threonyl-l-arginyl-l-glutaminyl-l-arginyl- ; peptide tyrosine tyrosine, human ; tyr-pro-ile-lys-pro-glu-ala-pro-gly-glu-asp-ala-ser-pro-glu-glu-leu-asn-arg-tyr-tyr-ala-ser-leu-arg-his-tyr-leu-asn-leu-val-thr-arg-gln-arg-tyr-nh2 ; peptide yy (human) acetate ; pyy (human) ; human peptide yy ; m.w. 4309.75 c194h295n55o57 ; peptide yy, human ; peptide yy (human)|peptide yy, pyy, human ; ypikpeapgedaspeelnryyaslrhylnlvtrqry-nh2
CAS:
118997-30-1
EINECS:
Molecular Formula:
C194H295N55O57
MDL:

Properties

Molecular Weight:
4309.75 g·mol−1

Safety Information

Hazard Classes:
WGK Germany:
3
Storage temperature:
-20°C



The following providers cannot be verified precisely. The companies have offered the product in the past, but despite all care, the companies could not confirm it 100 percent!

Bachem AG
About Bachem Bachem is a listed technology-based company focused on peptide chemistry. The company provides a full range of services to the pharma an... Request

What other providers are available for CAS 118997-30-1?

In addition to the providers presented here for Peptide YY (human) with the CAS number 118997-30-1, there are other 14 providers with slightly different product names available for this CAS number.

Leap Chem Co., Ltd | Skyrun Industrial Co., Ltd. +4 additional providers that we know from the past
+1 additional providers that we know from the past
+2 additional providers that we know from the past
+2 additional providers that we know from the past
+2 additional providers that we know from the past




Chemical-Suppliers
© Copyright 1996 to 2025 by Netvertise GmbH. All rights reserved. Reproduction of any materials from the site is strictly forbidden without permission.