Chemical-Suppliers
The independent directory of chemicals and chemical suppliers and producers.
BuyersGuideChem
BGC » Chemicals A-Z » Cecropin B
pr

Cecropin B

BGC Id:675412592653
CAS No:80451-05-4
Synonyms:cecropin b (platysamiacecropia antibacterial peptide) (9ci) ; kwkvfkkiekmgrnirngivkagpaiavlgeakal-nh2 ; aids096161 ; aids-096161 ; cecropin b ; h-lys-trp-lys-val-phe-lys-lys-ile-glu-lys-met-gly-arg-asn-ile-arg-asn-gly-ile-val-lys-ala-gly-pro-ala-ile-ala-val-leu-gly-glu-ala-lys-ala-leu-nh2
Molecular Formula:C176H301N51O42S1
Molecular Weight:3835.65
EINECS:
Structural Formula

2025 - The most valued supplier

The following 2 notable providers have been checked and can be recommended.
Chemical-Suppliers
Leap Chem
Molecular Formula: C176H302N52O41S Molecular Weight: 3834.66988 WGKGermany: 3

The last intensive check and update was carried out on 2025/02/21.

Identify

Synonyms:
cecropin b (platysamiacecropia antibacterial peptide) (9ci) ; kwkvfkkiekmgrnirngivkagpaiavlgeakal-nh2 ; aids096161 ; aids-096161 ; cecropin b ; h-lys-trp-lys-val-phe-lys-lys-ile-glu-lys-met-gly-arg-asn-ile-arg-asn-gly-ile-val-lys-ala-gly-pro-ala-ile-ala-val-leu-gly-glu-ala-lys-ala-leu-nh2
CAS:
80451-05-4
EINECS:
Molecular Formula:
C176H301N51O42S1
MDL:
MFCD00130753

Properties

Molecular Weight:
3835.65 g·mol−1

Suppliers

Leap Chem Co., Ltd

Tipo de companhia: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production. LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities. As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. Our client list includes many major pharmac ...
país: P.R.China   telefone: +852-30606658  

BIOZOL Diagnostica Vertrieb GmbH

Tipo de companhia: Supplier of chemical products
país: Germany
telefone: +49-871-966346-0
fax: +49-871-966346-13
Chemos®, a subsidiary of BIOZOL Diagnostica Vertrieb GmbH, is a leading supplier of ready to use solutions for the lab and chemical industry. We are producing reagents and standards for the analytical lab and supplying raw materials for the chemical and pharmaceutical industry. Nós somos vendedor de Butanoic acid 2,3-dihydroxypropyl ester. The base of our solutions are a portfolio of ~ 200.000 raw materials where ~ 50.000 are already available for R+D ready to order in our shop. We are supplying and producing lab quantities from tiny qua ...

Safety Information

Hazard Classes:
WGK Germany:
3
Storage temperature:
-20°C



The following providers cannot be verified precisely. The companies have offered the product in the past, but despite all care, the companies could not confirm it 100 percent!

Bachem AG
About Bachem Bachem is a listed technology-based company focused on peptide chemistry. The company provides a full range of services to the pharma an... Request

What other providers are available for CAS 80451-05-4?

In addition to the providers presented here for Cecropin B with the CAS number 80451-05-4, there are other 4 providers with slightly different product names available for this CAS number.

+1 additional providers that we know from the past
+2 additional providers that we know from the past




Chemical-Suppliers
© Copyright 1996 to 2025 by Netvertise GmbH. All rights reserved. Reproduction of any materials from the site is strictly forbidden without permission.