Chemical-Suppliers
The independent directory of chemicals and chemical suppliers and producers.
BuyersGuideChem
BGC » Chemicals A-Z » TIP-39
pr

TIP-39

BGC Id:803107415582
CAS No:277302-47-3
Synonyms:tuberoinfundibular neuropeptide ; tip 39, tuberoinfundibular neuropeptide ; tip 39 (39 mer) ; h-ser-leu-ala-leu-ala-asp-asp-ala-ala-phe-arg-glu-arg-ala-arg-leu-leu-ala-ala-leu-glu-arg-arg-his-trp-leu-asn-ser-tyr-met-his-lys-leu-leu-val-leu-asp-ala-pro-oh ; tip-39 ; l-proline, l-seryl-l-leucyl-l-alanyl-l-leucyl-l-alanyl-l-a-aspartyl-l-a-aspartyl-l-alanyl -l-alanyl-l-phenylalanyl-l-arginyl-l-a-glutamyl-l-arginyl-l-alanyl-l-arginyl- l-leucyl-l-leucyl-l-alanyl-l-alanyl-l-leucyl-l-a-glutamyl-l-arginyl-l-arginyl-l -histidyl-l-tryptophyl-l-leucyl-l-asparaginyl-l-seryl-l-tyrosyl-l-methionyl-l- histidyl-l-lysyl-l-leucyl-l-leucyl-l-valyl-l-leucyl-l-a-aspartyl-l-alanyl- ; ser-leu-ala-leu-ala-asp-asp-ala-ala-phe-arg-glu-arg-ala-arg-leu-leu-ala-ala-leu-glu-arg-arg-his-trp-leu-asn-ser-tyr-met-his-lys-leu-leu-val-leu-asp-ala-pro ; slaladdaafrerarllaalerrhwlnsymhkllvldap
Molecular Formula:C202H325N61O54S
Molecular Weight:
EINECS:
Structural Formula
Gelistet sind 2 internationale und zuverlässige Lieferanten für TIP-39. Sie kommen aus 1 Ländern auf der ganzen Welt. Diese Anbieter gehören zu 2 verschiedene Business-Typen wie 'Leading producer' und 'Bulk and laboratory supplier'
Bitte kontaktieren Sie alle unten aufgeführten Händler / Hersteller für TIP-39 und fragen Sie nach Preisen, Paketstandards und Transportmöglichkeiten. Unsere registrierten Distributoren helfen Ihnen, alle notwendigen Informationen und Produktspezifikationen zu erhalten.


supplier ww
Registrierte Lieferanten von TIP-39 weltweit

The most competitive supplier in 2022

The following 2 notable providers have been checked and can be recommended.
Chemical-Suppliers
Leap Chem
Molecular Formula: C202H325N61O54S WGKGermany: 3

The last intensive check and update was carried out on 2022/12/07.

Identify

Synonyms:
tuberoinfundibular neuropeptide ; tip 39, tuberoinfundibular neuropeptide ; tip 39 (39 mer) ; h-ser-leu-ala-leu-ala-asp-asp-ala-ala-phe-arg-glu-arg-ala-arg-leu-leu-ala-ala-leu-glu-arg-arg-his-trp-leu-asn-ser-tyr-met-his-lys-leu-leu-val-leu-asp-ala-pro-oh ; tip-39 ; l-proline, l-seryl-l-leucyl-l-alanyl-l-leucyl-l-alanyl-l-a-aspartyl-l-a-aspartyl-l-alanyl -l-alanyl-l-phenylalanyl-l-arginyl-l-a-glutamyl-l-arginyl-l-alanyl-l-arginyl- l-leucyl-l-leucyl-l-alanyl-l-alanyl-l-leucyl-l-a-glutamyl-l-arginyl-l-arginyl-l -histidyl-l-tryptophyl-l-leucyl-l-asparaginyl-l-seryl-l-tyrosyl-l-methionyl-l- histidyl-l-lysyl-l-leucyl-l-leucyl-l-valyl-l-leucyl-l-a-aspartyl-l-alanyl- ; ser-leu-ala-leu-ala-asp-asp-ala-ala-phe-arg-glu-arg-ala-arg-leu-leu-ala-ala-leu-glu-arg-arg-his-trp-leu-asn-ser-tyr-met-his-lys-leu-leu-val-leu-asp-ala-pro ; slaladdaafrerarllaalerrhwlnsymhkllvldap
CAS:
277302-47-3
EINECS:
Molecular Formula:
C202H325N61O54S
MDL:

Suppliers

Dayang Chem (Hangzhou) Co.,Ltd.

Unternehmensart: Leading producer
Hangzhou DayangChem Co. Ltd is a comprehensive entity which specializes in development, production and trade of pharmaceutical, agrochemical and dyestuff intermediates as well as some special type reagents. We have an own factory and share enterprises. Dayang Chem (Hangzhou) Co.,Ltd. ist Verkäufer von (3S,4S,6R)-3-hexyltetrahydro-4-hydroxy-6-undecyl-2H-pyran-2-one. We act also as agent of many chemical factories and promote their products to the international market at very competitive price. We take "Credi first, Clients supreme" as our aim. We expect to cooperate with more partners in ...
Land: P.R.China   Telefon: +86-571-88938639   Fax: +86-571-8893-8652

Leap Chem Co., Ltd

Unternehmensart: Bulk and laboratory supplier
Land: P.R.China
Telefon: +852-30606658
LEAPChem, a specialized fine chemicals supplier for research, development and production. LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities. As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. Our client list includes many major pharmac ...

Safety Information

Hazard Classes:
WGK Germany:
3
Storage temperature:
-20°C



The following providers cannot be verified precisely. The companies have offered the product in the past, but despite all care, the companies could not confirm it 100 percent!

Bachem AG
About Bachem Bachem is a listed technology-based company focused on peptide chemistry. The company provides a full range of services to the pharma an... Request

What other providers are available for CAS 277302-47-3?

In addition to the providers presented here for TIP-39 with the CAS number 277302-47-3, there are other 4 providers with slightly different product names available for this CAS number.

+1 additional providers that we know from the past
+2 additional providers that we know from the past




Chemical-Suppliers
© Copyright 1996 to 2025 by Netvertise GmbH. All rights reserved. Reproduction of any materials from the site is strictly forbidden without permission.