Chemical-Suppliers
The independent directory of chemicals and chemical suppliers and producers.
BuyersGuideChem
BGC » Chemicals A-Z » Adenylate cyclase activating p...
pr

Adenylate cyclase activating peptide-27

BGC Id:932285645863
CAS No:127317-03-7
Synonyms:pituitary adenylatecyclase-activating peptide-27 (human) (9ci) ; 30: pn: wo2007058336 seqid: 30claimed protein ; peptide pacap 27 (sheep) ; 3: pn: wo2004048401 seqid: 3 claimedprotein ; m-pacap ; ovine pacap 27 ; pituitary adenylate cyclase-activatingpolypeptide-27 (human) ; pacap-27 (human, ovine, rat) ; powdered posterior pitultary ; vasoactiveintestinal octacosapeptide (pig),4-glycine-5-l-isoleucine-9-l-serine-11-l-serine-13-l-tyrosine-24-l-alanine-25-l-alanine-26-l-valine-27-l-leucinamide-28-de-l-aspartamide- ; pacap 1-27 ; pacap-27 ; pacap (1-27), human, ovine, rat ; pacap (1-27) amide ; human pacap-(1-27) ; hsdgiftdsysryrkqmavkkylaavl-nh2 ; 37: pn: jp2004315436 seqid: 23 claimed sequence ; 22: pn: wo2009099763 seqid: 659 claimed protein ; pacap (1-27) (human, sheep, rat) ; human pacap-27 ; 3: pn:us20050203009 seqid: 3 claimed protein ; pacap 27 amide, ovine ; pituitary adenylatecyclase-activating peptide-27 (sheep) ; rat pacap-27 ; l-leucinamide, l-histidyl-l-seryl-l-a-aspartylglycyl-l-isoleucyl-l-phenylalanyl-l-threonyl-l-a-aspartyl-l-seryl-l-tyrosyl-l-seryl-l-arginyl-l-tyrosyl-l-arginyl-l-lysyl-l-glutaminyl-l-methionyl-l-alanyl-l-valyl-l-lysyl-l-lysyl-l-tyrosyl-l-leucyl-l-alanyl-l-alanyl-l-valyl-
Molecular Formula:C142H224 N40 O39 S
Molecular Weight:3147.61
EINECS:
Structural Formula

The most competitive supplier in 2025

The following 2 notable providers have been checked and can be recommended.
The last intensive check and update was carried out on 2025/02/21.

Identify

Synonyms:
pituitary adenylatecyclase-activating peptide-27 (human) (9ci) ; 30: pn: wo2007058336 seqid: 30claimed protein ; peptide pacap 27 (sheep) ; 3: pn: wo2004048401 seqid: 3 claimedprotein ; m-pacap ; ovine pacap 27 ; pituitary adenylate cyclase-activatingpolypeptide-27 (human) ; pacap-27 (human, ovine, rat) ; powdered posterior pitultary ; vasoactiveintestinal octacosapeptide (pig),4-glycine-5-l-isoleucine-9-l-serine-11-l-serine-13-l-tyrosine-24-l-alanine-25-l-alanine-26-l-valine-27-l-leucinamide-28-de-l-aspartamide- ; pacap 1-27 ; pacap-27 ; pacap (1-27), human, ovine, rat ; pacap (1-27) amide ; human pacap-(1-27) ; hsdgiftdsysryrkqmavkkylaavl-nh2 ; 37: pn: jp2004315436 seqid: 23 claimed sequence ; 22: pn: wo2009099763 seqid: 659 claimed protein ; pacap (1-27) (human, sheep, rat) ; human pacap-27 ; 3: pn:us20050203009 seqid: 3 claimed protein ; pacap 27 amide, ovine ; pituitary adenylatecyclase-activating peptide-27 (sheep) ; rat pacap-27 ; l-leucinamide, l-histidyl-l-seryl-l-a-aspartylglycyl-l-isoleucyl-l-phenylalanyl-l-threonyl-l-a-aspartyl-l-seryl-l-tyrosyl-l-seryl-l-arginyl-l-tyrosyl-l-arginyl-l-lysyl-l-glutaminyl-l-methionyl-l-alanyl-l-valyl-l-lysyl-l-lysyl-l-tyrosyl-l-leucyl-l-alanyl-l-alanyl-l-valyl-
CAS:
127317-03-7
EINECS:
Molecular Formula:
C142H224 N40 O39 S
MDL:

Properties

Molecular Weight:
3147.61 g·mol−1
download Download Molfile for :
PACAP 1-27

Suppliers

Dayang Chem (Hangzhou) Co.,Ltd.

Unternehmensart: Leading producer
Hangzhou DayangChem Co. Ltd is a comprehensive entity which specializes in development, production and trade of pharmaceutical, agrochemical and dyestuff intermediates as well as some special type reagents. We have an own factory and share enterprises. Wir verkaufen selbstverständlich auch 4-Amino-6,7-dimethylquinoline. We act also as agent of many chemical factories and promote their products to the international market at very competitive price. We take "Credi first, Clients supreme" as our aim. We expect to cooperate with more partners in ...
Land: P.R.China   Telefon: +86-571-88938639   Fax: +86-571-8893-8652

BIOZOL Diagnostica Vertrieb GmbH

Unternehmensart: Supplier of chemical products
Land: Germany
Telefon: +49-871-966346-0
Fax: +49-871-966346-13
Chemos®, a subsidiary of BIOZOL Diagnostica Vertrieb GmbH, is a leading supplier of ready to use solutions for the lab and chemical industry. We are producing reagents and standards for the analytical lab and supplying raw materials for the chemical and pharmaceutical industry. The base of our solutions are a portfolio of ~ 200.000 raw materials where ~ 50.000 are already available for R+D ready to order in our shop. BIOZOL Diagnostica Vertrieb GmbH bietet auch 2,6-Dimethoxybenzylbromide an. We are supplying and producing lab quantities from tiny qua ...

Safety Information

Hazard Classes:
WGK Germany:
3
Storage temperature:
-20°C

What other providers are available for CAS 127317-03-7?

In addition to the providers presented here for Adenylate cyclase activating peptide-27 with the CAS number 127317-03-7, there are other 19 providers with slightly different product names available for this CAS number.

Shandong Ench Chemical Co.,Ltd +1 additional providers that we know from the past
+1 additional providers that we know from the past
BOC Sciences
+1 additional providers that we know from the past
+4 additional providers that we know from the past
+2 additional providers that we know from the past
+3 additional providers that we know from the past
Leap Chem Co., Ltd +4 additional providers that we know from the past




Chemical-Suppliers
© Copyright 1996 to 2025 by Netvertise GmbH. All rights reserved. Reproduction of any materials from the site is strictly forbidden without permission.