Chemical-Suppliers
The independent directory of chemicals and chemical suppliers and producers.
BuyersGuideChem
BGC » Chemicals A-Z » Glucagon-Like Peptide 1 (7-36)...
pr

Glucagon-Like Peptide 1 (7-36), amide, human;HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2

BGC Id:165295120189
CAS No:107444-51-9
Synonyms:7-36-humanglucagon-like peptide i amide ; insulinotropin (human) ; 774: pn: wo2004074315 seqid: 775 claimedprotein ; glp-1 (7-36) or (7-37) ; glp-i (7-36) ; (7-36)glucagon-like peptide-1 amide(human) ; glp-1-(7-36) amide ; glp-1 [7-36] ; preproglucagon 78-107 amide ; glp-1 (7-36) amide acetate ; (7-36)glucagon-like peptide-1 amide ; humanglucagon-like peptide-1-(7-36) amide ; glp-1 (7-36) amide (human) ; glucagon-relatedpeptide 1 (rana catesbeiana), 3-l-glutamicacid-10-l-valine-16-glycine-17-l-glutamine-23-l-isoleucine-24-l-alanine-27-l-valine-30-l-argininamide-31-de-l-proline-32-de-l-lysine- ; glp-1(7-36) acetate ; glucagon-likepeptidei(7-36 ; human glp-1-(7-36)-amide ; glucagon-like peptide-i(7-36) amide ; m.w. 3297.67 c149h226n40o45 ; insulinotropin
Molecular Formula:C149H226N40O45
Molecular Weight:3297.67
EINECS:
Structural Formula

Identify

Synonyms:
7-36-humanglucagon-like peptide i amide ; insulinotropin (human) ; 774: pn: wo2004074315 seqid: 775 claimedprotein ; glp-1 (7-36) or (7-37) ; glp-i (7-36) ; (7-36)glucagon-like peptide-1 amide(human) ; glp-1-(7-36) amide ; glp-1 [7-36] ; preproglucagon 78-107 amide ; glp-1 (7-36) amide acetate ; (7-36)glucagon-like peptide-1 amide ; humanglucagon-like peptide-1-(7-36) amide ; glp-1 (7-36) amide (human) ; glucagon-relatedpeptide 1 (rana catesbeiana), 3-l-glutamicacid-10-l-valine-16-glycine-17-l-glutamine-23-l-isoleucine-24-l-alanine-27-l-valine-30-l-argininamide-31-de-l-proline-32-de-l-lysine- ; glp-1(7-36) acetate ; glucagon-likepeptidei(7-36 ; human glp-1-(7-36)-amide ; glucagon-like peptide-i(7-36) amide ; m.w. 3297.67 c149h226n40o45 ; insulinotropin
CAS:
107444-51-9
EINECS:
Molecular Formula:
C149H226N40O45
MDL:

Properties

Molecular Weight:
3297.67 g·mol−1
Density:
1.47 g/cm3
download Download Molfile for :
Glucagon-Like Peptide 1 (7-36) Amide

Safety Information

Hazard Classes:
WGK Germany:
3
Storage temperature:
-20°C

What other providers are available for CAS 107444-51-9?

In addition to the providers presented here for Glucagon-Like Peptide 1 (7-36), amide, human;HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 with the CAS number 107444-51-9, there are other 43 providers with slightly different product names available for this CAS number.

Simagchem Corporation | Amadis Chemical Company Limited | Xiamen Equation Chemical Co.,Ltd +8 additional providers that we know from the past
BOC Sciences | Leap Chem Co., Ltd +3 additional providers that we know from the past
+4 additional providers that we know from the past
Wuhan PharmChem Co., LTD. | Finetech Industry Limited | Leap Chem Co., Ltd | BuGuCh & Partners +7 additional providers that we know from the past
+1 additional providers that we know from the past
+3 additional providers that we know from the past
+2 additional providers that we know from the past




Chemical-Suppliers
© Copyright 1996 to 2025 by Netvertise GmbH. All rights reserved. Reproduction of any materials from the site is strictly forbidden without permission.