BGC Id: | 675412592653 | |
CAS No: | 80451-05-4 | |
Synonyms: | cecropin b (platysamiacecropia antibacterial peptide) (9ci) ; kwkvfkkiekmgrnirngivkagpaiavlgeakal-nh2 ; aids096161 ; aids-096161 ; cecropin b ; h-lys-trp-lys-val-phe-lys-lys-ile-glu-lys-met-gly-arg-asn-ile-arg-asn-gly-ile-val-lys-ala-gly-pro-ala-ile-ala-val-leu-gly-glu-ala-lys-ala-leu-nh2 | |
Molecular Formula: | C176H301N51O42S1 | |
Molecular Weight: | 3835.65 | |
EINECS: |
Chemos®, a subsidiary of BIOZOL Diagnostica Vertrieb GmbH, is a leading supplier of ready to use solutions for the lab and chemical industry. We are producing reagents and standards for the analytical lab and supplying raw materials for the chemical and pharmaceutical industry. Мы продавцом Butanoic acid 2,3-dihydroxypropyl ester. The base of our solutions are a portfolio of ~ 200.000 raw materials where ~ 50.000 are already available for R+D ready to order in our shop. We are supplying and producing lab quantities from tiny qua ... |