|
|
Tyr-CRF (ovine)
Synonyms: tyr-ser-gln-glu-pro-pro-ile-ser-leu-asp-leu-thr-phe-his-leu-leu-arg-glu-val-leu-glu-met-thr-lys-ala-asp-gln-leu-ala-gln-gln-ala-his-ser-asn-arg-lys-leu-leu-asp-ile-ala-nh2 ovine | [tyr0]-corticotropin releasing factor, ovine | tyrosine-corticotropin releasing factor bovine) | ysqeppisldltfhllrevlemtkadqlaqqahsnrklldia-nh2 | crf ovine | h-tyr-ser-gln-glu-pro-pro-ile-ser-leu-asp-leu-thr-phe-his-leu-leu-arg-glu-val-leu-glu-met-thr-lys-ala-asp-gln-leu-ala-gln-gln-ala-his-ser-asn-arg-lys-leu-leu-asp-ile-ala-nh2 | tyr-corticotropin releasing factor ovine | tyr-crf (ovine) | [tyr0]-crf ovine
List of Suppliers
Bachem AG
Company type: Leading producer
About Bachem
Bachem is a listed technology-based company focused on peptide chemistry. The company provides a full range of services to the pharma and biotech industries. Bachem AG also offers pTH (1-84) (dog). It specializes in the development of innovative, efficient manufacturing processes and the reliable production of peptide-based active pharmaceutical ingredients. A comprehensive catalog of biochemicals and exclusive custom syntheses for research labs complete the service portfolio. Bachem AG is supplier for Tyr-CRF (ovine). Headquartered in Swi ...
Country: Switzerland
Phone: +41 58 595 2021
Telefax: +41 58 595 2040
Safety Information
Storage tempuraturx: -20°C
Most viewed
Within the past time user are also interested in the following chemicals.
Suppliers and manufactures - with identical CAS number as Tyr-CRF (ovine)
For the following products supplier are listed below:
H-Tyr-Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2
The following companies are not suppliers of Tyr-CRF (ovine) . This companies are suppliers for equal products with the same CAS number. CAS: 83930-34-1
Leap Chem Co., Ltd
Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production.
LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities. 5-Amino-2,4-dimethylphenol will be also provided by us.
As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner.
Our client list includes many m ...
Country: P.R.China
Phone: +852-30606658
Telefax:
Related products:
|
|
|
How do you find new customers?
click here
Shouguang Nuomeng Chemi
Shouguang Nuomeng Chemical Co., Ltd., established in 2008, is located in Houzhen Industrial Park of
Hangzhou Proserre Chemi
Hangzhou Proserre Chemical Co., LTD established in Dec 2013 is a marketing, contract manufacturing,
Corvay Specialty Chemic
Corvay Specialty Chemicals GmbH distributes high quality specialty chemicals from selected manufact
Suzhou Bichal Biologica
SUZHOU BICHAL BIOLOGICAL TECHNOLOGY CO., LTD is a fast-growing pharmaceutical company that engages
Chemlyte Solutions
At Chemlyte Solutions, we place long-term relationships and outstanding client experience at the he
Zhengzhou Key-chemi Bio
Zhengzhou Key-chemi biotechnology co., LTD. is a high-tech company committed to the field of chemic
|