|
|
GHRF, ovine
Synonyms: ghrf ovine | grf (ovine) | grf (1-44) (ovine) | grf (1-44) (ovine, caprine) | growth hormone releasing factor, ovine | growth hormone releasing factor (1-44) (ovine) | yadaiftnsyrkilgqlsarkllqdimnrqqgernqeqgakvrl-nh2 | growth hormone-releasing factor (1-44) (ovine, caprine) | h-tyr-ala-asp-ala-ile-phe-thr-asn-ser-tyr-arg-lys-ile-leu-gly-gln-leu-ser-ala-arg-lys-leu-leu-gln-asp-ile-met-asn-arg-gln-gln-gly-glu-arg-asn-gln-glu-gln-gly-ala-lys-val-arg-leu-nh2 | somatoliberin(human pancreatic islet), 13-l-isoleucine-28-l-asparagine-34-l-arginine-38-l-glutamine-41-l-lysine-42-l-valine- | l-leucinamide, l-tyrosyl-l-alanyl-l-a-aspartyl-l-alanyl-l-isoleucyl-l-phenylalanyl-l-threonyl-l-asparaginyl-l-seryl-l-tyrosyl-l-arginyl-l-lysyl-l-isoleucyl-l-leucylglycyl-l-glutaminyl-l-leucyl-l-seryl-l-alanyl-l-arginyl-l-lysyl-l-leucyl-l-leucyl-l-glutaminyl-l-a-aspartyl-l-isoleucyl-l-methionyl-l-asparaginyl-l-arginyl-l-glutaminyl-l-glutaminylglycyl-l-a-glutamyl-l-arginyl-l-asparaginyl-l-glutaminyl-l-a-glutamyl-l-glutaminylglycyl-l-alanyl-l-lysyl-l-valyl-l-arginyl- | somatoliberin (sheephypothalamus) (9ci)
Formula: C221H368 N72 O66 S
List of Suppliers
Leap Chem Co., Ltd
Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production. We sell 4-{[4-(Trifluoromethyl)pyrimidin-2-yl]oxy}benzoic acid as well.
LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities.
As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. Leap Chem Co., Ltd is supplier for GHRF, ovine.
Our client list includes many m ...
Country: P.R.China
Phone: +852-30606658
Telefax:
Safety Information
Storage tempuraturx: -15°C
Most viewed
Within the past time user are also interested in the following chemicals.
Suppliers and manufactures - with identical CAS number as GHRF, ovine
For the following products supplier are listed below:
GRF (ovine, caprine)
Bachem AG
Company type: Leading producer
About Bachem
Bachem is a listed technology-based company focused on peptide chemistry. The company provides a full range of services to the pharma and biotech industries. Bachem AG also offers Proadrenomedullin (1-20) (human). It specializes in the development of innovative, efficient manufacturing processes and the reliable production of peptide-based active pharmaceutical ingredients. A comprehensive catalog of biochemicals and exclusive custom syntheses for research labs complete the service portfolio. Headquartered in Swi ...
Country: Switzerland
Phone: +41 58 595 2021
Telefax: +41 58 595 2040
|
|
|
How do you find new customers?
click here
Syntop Chemical Co Ltd
Syntop chemical Co.,Ltd. is a professional wax supplier from China .We have owned wax fact
Nation Ford Chemical Co
Founded in 1978, Nation Ford Chemical is one of America’s most respected custom and toll manufactur
Shanghai Juyuan Flame R
Shanghai Juyuan Flame-Retardant Material Co., Ltd is an enterprise professionally producing and man
Henan Sinowin Che
Henan Sinowin Chemical Industry Co.,Ltd. is established in 2003, it's located in Zhengzhou industri
Autech Industry Co.,Lim
Autech Industry Co., Ltd was established in 2006, the head office is in Jinan City, Shandong Provin
Hangzhou Cherry Pharmac
Hangzhou Cherry Pharmaceutical Technology Co., LTD is a marketing company from China engaged in pha
|