www.BuyersGuideChem.com - directory for chemicals and chemical suppliers
Productname:

BGC > Chemicals A-Z > Peptide YY, human

Peptide YY, human

Quick view: Suppliers
BGC Id:
595246816588
CAS No.:
Synonyms:
peptide tyrosine tyrosine, human | peptide yy (human) acetate | l-tyrosinamide, l-tyrosyl-l-prolyl-l-isoleucyl-l-lysyl-l-prolyl-l-α-glutamyl-l-alanyl-l-prolylglycyl-l-α-glutamyl-l-α-aspartyl-l-alanyl-l-seryl-l-prolyl-l-α-glutamyl-l-α-glutamyl-l-leucyl-l-asparaginyl-l-arginyl-l-tyrosyl-l-tyrosyl-l-alanyl-l-seryl-l-leucyl-l-arginyl-l-histidyl-l-tyrosyl-l-leucyl-l-asparaginyl-l-leucyl-l-valyl-l-threonyl-l-arginyl-l-glutaminyl-l-arginyl- | ypikpeapgedaspeelnryyaslrhylnlvtrqry-nh2 | tyr-pro-ile-lys-pro-glu-ala-pro-gly-glu-asp-ala-ser-pro-glu-glu-leu-asn-arg-tyr-tyr-ala-ser-leu-arg-his-tyr-leu-asn-leu-val-thr-arg-gln-arg-tyr-nh2 | peptide yy, human | human peptide yy | peptide yy (human)|peptide yy, pyy, human | pyy (human) | m.w. 4309.75 c194h295n55o57 | peptide yy pyy human
Formula:
C194H295N55O57
Molecular Weight:
4309.75

List of Suppliers

Skyrun Industrial Co., Ltd.

Company type: Leading producer
Skyrun Industrial Co.Limited, established in 2003, a state-controlled company (By Skyrun Corp. & High Hope) in China, specializing in developing, producing and handing raw pharmaceutical material and intermediates. We sell (S)-2-Phenyl-1-propylamine as well. Skyrun Industrial Co., Ltd. is supplier for Peptide YY, human. We have expanded a compositive entity from initially only as a small manufacturer. We have extensive knowledge of domestic and international pharmaceutical markets. Our working range can be start from small amount in research stage to big bulk for industrial produc ...
Country: P.R.China   Phone: +86-576-84015261   Telefax: +86-576-84015261

Leap Chem Co., Ltd

Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production. Leap Chem Co., Ltd is supplier for Peptide YY, human. LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities. Leap Chem Co., Ltd also offers 11beta,21-Dihydroxypregna-4,17(20)-dien-3-one 21-acetate. As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. Our client list includes many m ...
Country: P.R.China   Phone: +852-30606658   Telefax:

Safety Information

WGK Germany:
3
Storage tempuraturx:
-20°C

Most viewed

Within the past time user are also interested in the following chemicals.

Suppliers and manufactures - with identical CAS number as Peptide YY, human

For the following products supplier are listed below:
    Peptide YY (human)


The following companies are not suppliers of Peptide YY, human . This companies are suppliers for equal products with the same CAS number. CAS: 118997-30-1


Supplier of

Peptide YY (human)

(CAS: 118997-30-1)

BuGuCh & Partners

Company type: Analytical Institution
We, BuGuCh & Partners, are an international acting and innovative company, leading in developing and manufacturing. We operates major facilities in North America, Europe and the Pacific Rim, as well as facilities in China, Japan and Saudi Arabia operated through joint ventures. We maintain independently or are partners of some production sites in Europe, Asia and South America. We sell Thioproperazine as well. Our global network is a strength. Our products range from natural gas, oil and basic chemi ...
Country: Germany   Phone:   Telefax:

Bachem AG

Company type: Leading producer
About Bachem Bachem is a listed technology-based company focused on peptide chemistry. The company provides a full range of services to the pharma and biotech industries. It specializes in the development of innovative, efficient manufacturing processes and the reliable production of peptide-based active pharmaceutical ingredients. We supply our chemical product H-D-Tyr-Val-NH2. A comprehensive catalog of biochemicals and exclusive custom syntheses for research labs complete the service portfolio. Headquartered in Swi ...
Country: Switzerland   Phone: +41 58 595 2021   Telefax: +41 58 595 2040


Language:
english português français deutsch español
svensk norsk italiano 中国 日本語 по-русски




How do you find
new customers?

click here


Allfluoro Pharmaceutica
Founded in 2015, Allfluoro pharmaceutical co. ltd. (AFPA) is a privately held, organic fluorine com


Suzhou Bichal Biologica
SUZHOU BICHAL BIOLOGICAL TECHNOLOGY CO., LTD is a fast-growing pharmaceutical company that engages


Jiangsu Tetra New Mater
Tetrachem is a high-tech company specialized in R&D, production, sales and technical service of


Chemport Science & Tech
Chemport is a R&D oriented company, providing innovative synthesis solutions to the customers i


Akzo Nobel Functional C
AkzoNobel continues to develop its position as the global leader in MCA with interregional supply c


Rech Chemical Co., Ltd.
Twenties years ago, Rech Chemical Co.,Ltd were mainly a solid manganese sulphate supplier. Today, b


© Copyright 1996 to 2024 by Netvertise GmbH. All rights reserved Peptide YY, human