www.BuyersGuideChem.com - directory for chemicals and chemical suppliers
Productname:

BGC > Chemicals A-Z > Parathyroid Hormone (1-34), bovine

Parathyroid Hormone (1-34), bovine

Quick view: Suppliers
BGC Id:
845221340232
CAS No.:
Synonyms:
teriparatide | l-phenylalanine,l-alanyl-l-valyl-l-seryl-l-a-glutamyl-l-isoleucyl-l-glutaminyl-l-phenylalanyl-l-methionyl-l-histidyl-l-asparaginyl-l-leucylglycyl-l-lysyl-l-histidyl-l-leucyl-l-seryl-l-seryl-l-methionyl-l-a-glutamyl-l-arginyl-l-valyl-l-a-glutamyl-l-tryptophyl-l-leucyl-l-arginyl-l-lysyl-l-lysyl-l-leucyl-l-glutaminyl-l-a-aspartyl-l-valyl-l-histidyl-l-asparaginyl- | 1-34-bovine pth | bovine pth-(1-34) | parathyroid hormone (1-34), bovine | parathyroid hormone bovine: fragment 1-34 | bovine parathormone 1-34 | ala-val-ser-glu-ile-gln-phe-met-his-asn-leu-gly-lys-his-leu-ser-ser-met-glu-arg-val-glu-trp-leu-arg-lys-lys-leu-gln-asp-val-his-asn-phe | 1-34-bovineparathormone | bovineparathyroidhormone(1-34 | pth (1-34) (bovine) | alanine,l-alanyl-l-valyl-l-seryl-l-glutamyl-l-isoleucyl-l-glutaminyl-l-phenylalanyl-l-methionyl-l-histidyl-l-asparaginyl-l-leucylglycyl-l-lysyl-l-histidyl-l-leucyl-l-seryl-l-seryl-l-methionyl-l-glutamyl-l-arginyl-l-valyl-l-glutamyl-l-tryptophyl-l-leucyl-l-arginyl-l-lysyl-l-lysyl-l-leucyl-l-glutaminyl-l-aspartyl-l-valyl-l-histidyl-l-asparaginylphenyl-,l- (8ci) | bovine parathyroidhormone-(1-34) | bpth 1-34 | 20: pn: wo0181415 seqid: 22 claimedprotein | 1-34-parathormone (ox) | 1-34 bovine parathyroid hormone | parathyroid hormone fragment 1-34 bovine | avseiqfmhnlgkhlssmervewlrkklqdvhnf
Formula:
C183H288 N54 O50 S2
Molecular Weight:
4108.71

List of Suppliers

Alpha Biopharmaceuticals Co., Ltd.

Company type: Producer
Alabiochem company locates at a beautiful chinese city-SuZhou. Fmoc-D-Arg(Boc)2-OH will be also provided by us. We are a professional biochemical company engaged in researching, developing, manufacturing pharmaceutical peptide、new amino acid, peptide synthetic technique and new type of peptide. Moreover, we are focused on nucleic acid and other small organic compounds. Alpha Biopharmaceuticals Co., Ltd. is supplier for Parathyroid Hormone (1-34), bovine. Alabiochem company not only provides contact research but custom synthesis service.
Country: P.R.China   Phone: +86-411-39042497   Telefax: +86-411-39042693

Leap Chem Co., Ltd

Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production. LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities. As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. Leap Chem Co., Ltd is a seller of 684238-37-7. Leap Chem Co., Ltd is supplier for Parathyroid Hormone (1-34), bovine. Our client list includes many m ...
Country: P.R.China   Phone: +852-30606658   Telefax:

Specification

Solubility:
Soluble in water.
Appearance:
powder

Safety Information

WGK Germany:
3
Storage tempuraturx:
-20°C

Most viewed

Within the past time user are also interested in the following chemicals.

Suppliers and manufactures - with identical CAS number as Parathyroid Hormone (1-34), bovine

For the following products supplier are listed below:
    pTH (1-34) (bovine)


The following companies are not suppliers of Parathyroid Hormone (1-34), bovine . This companies are suppliers for equal products with the same CAS number. CAS: 12583-68-5


Supplier of

pTH (1-34) (bovine)

(CAS: 12583-68-5)

BuGuCh & Partners

Company type: Analytical Institution
We, BuGuCh & Partners, are an international acting and innovative company, leading in developing and manufacturing. We operates major facilities in North America, Europe and the Pacific Rim, as well as facilities in China, Japan and Saudi Arabia operated through joint ventures. We maintain independently or are partners of some production sites in Europe, Asia and South America. Additionally 4-Isocyanatobenzoyl chloride is supplied by us. Our global network is a strength. Our products range from natural gas, oil and basic chemi ...
Country: Germany   Phone:   Telefax:

Bachem AG

Company type: Leading producer
About Bachem Bachem is a listed technology-based company focused on peptide chemistry. The company provides a full range of services to the pharma and biotech industries. It specializes in the development of innovative, efficient manufacturing processes and the reliable production of peptide-based active pharmaceutical ingredients. H-Lys-Pro-Tyr-OH is also served by Bachem AG. A comprehensive catalog of biochemicals and exclusive custom syntheses for research labs complete the service portfolio. Headquartered in Swi ...
Country: Switzerland   Phone: +41 58 595 2021   Telefax: +41 58 595 2040


Related products:


Language:
english português français deutsch español
svensk norsk italiano 中国 日本語 по-русски




How do you find
new customers?

click here


Anhui Cheer-Our Medical
ANHUI CHEER-OUR MEDICAL TECHNOLOGY CO.,LTD is one company mainly manufacturing, developing and supp


ReseaChem
Service laboratory focused on analytics and synthesis.Only laboratory in Switzerland with guaran


Hangzhou Cherry Pharmac
Hangzhou Cherry Pharmaceutical Technology Co., LTD is a marketing company from China engaged in pha


Anderson Development Co
Anderson Development Company is an award winning specialty and custom chemical manufacturer with a


Tianjin Security Techno
Tianjin Security Technology Development Ltd Co. is a hi-tech enterprise with self-governed legal pe


Unilong Industry Co.,Lt
Unilong Industry Co.,Ltd. is a growing high-tech chemical enterprise, and located in Zibo Zhangdian


© Copyright 1996 to 2024 by Netvertise GmbH. All rights reserved Parathyroid Hormone (1-34), bovine