PACAP-38 (6-38) (human, chicken, mouse, ovine, porcine, rat)
Synonyms: pacap (6-38), amide, human, ovine, rat | pacap (6-38), human, ovine, rat | l-lysinamide,l-phenylalanyl-l-threonyl-l-a-aspartyl-l-seryl-l-tyrosyl-l-seryl-l-arginyl-l-tyrosyl-l-arginyl-l-lysyl-l-glutaminyl-l-methionyl-l-alanyl-l-valyl-l-lysyl-l-lysyl-l-tyrosyl-l-leucyl-l-alanyl-l-alanyl-l-valyl-l-leucylglycyl-l-lysyl-l-arginyl-l-tyrosyl-l-lysyl-l-glutaminyl-l-arginyl-l-valyl-l-lysyl-l-asparaginyl- | pacap (6-38) (human, sheep, rat) | human pacap(6-38) | 18:pn: wo2009031916 page: 7 claimed protein | ftdsysryrkqmavkkylaavlgkrykqrvknk-nh2 | pituitary adenylate cyclase activating polypeptide (human, 6-38) ovine, rat | pacap 6-38 | pituitary adenylate activating polypeptide (6-38) (human, ovine, rat) | pacap (human, 6-38) (ovine, rat) | pacap-38 (6-38) (human, chicken, mouse, ovine, porcine, rat) | rat pacap(6-38) | pituitary adenylate cyclase activating peptide (6-38), human, ovine, rat
Formula: C182H300 N56 O45 S
List of Suppliers
Bachem AG
Company type: Leading producer
About Bachem
Bachem is a listed technology-based company focused on peptide chemistry. Bachem AG is supplier for PACAP-38 (6-38) (human, chicken, mouse, ovine, porcine, rat). The company provides a full range of services to the pharma and biotech industries. It specializes in the development of innovative, efficient manufacturing processes and the reliable production of peptide-based active pharmaceutical ingredients. A comprehensive catalog of biochemicals and exclusive custom syntheses for research labs complete the service portfolio. We sell Suc-Leu-Leu-Val-Tyr-AMC as well. Headquartered in Swi ...
Country: Switzerland
Phone: +41 58 595 2021
Telefax: +41 58 595 2040
Safety Information
Storage tempuraturx: -15°C
Most viewed
Within the past time user are also interested in the following chemicals.
Chloroacetic acid sodium salt
1-Benzhydrylperhydro-1,4-diazepine
L-alpha-Glycerophosphoryl choline
Suppliers and manufactures - with identical CAS number as PACAP-38 (6-38) (human, chicken, mouse, ovine, porcine, rat)
For the following products supplier are listed below:
PACAP (6-38), amide, human, ovine, rat
The following companies are not suppliers of PACAP-38 (6-38) (human, chicken, mouse, ovine, porcine, rat) . This companies are suppliers for equal products with the same CAS number. CAS: 143748-18-9
Alpha Biopharmaceuticals Co., Ltd.
Company type: Producer
Alabiochem company locates at a beautiful chinese city-SuZhou. We are a professional biochemical company engaged in researching, developing, manufacturing pharmaceutical peptide、new amino acid, peptide synthetic technique and new type of peptide. We provide Boc-N-Me-Abu(4)-OH as well. Moreover, we are focused on nucleic acid and other small organic compounds. Alabiochem company not only provides contact research but custom synthesis service.
Country: P.R.China
Phone: +86-411-39042497
Telefax: +86-411-39042693
Leap Chem Co., Ltd
Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production.
LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities. We sell 2,4-Dichloro-4'-piperidinomethyl benzophenone as well.
As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner.
Our client list includes many m ...
Country: P.R.China
Phone: +852-30606658
Telefax:
Related products:
|
