|
|
|
Interferon alfa-2A
Synonyms: interferon-.alpha.-consensus | 7: pn: wo0069913 seqid: 9 claimedprotein | canferon | canferon a | ifn-aa | interferon a2 (human) | ro 22-8181 | a.-ifn | alpha ifn | interferon aa | aids-000156 | interferon aa (human leukocyte protein moietyreduced) (9ci) | ifnalpha-2a | roferon-a | cdlpqthslonrralillaqmgrispfsclkdrhdfgfpqeefdgnqfqkaqaisvlhemiqqtfnlfstkdssatwdesllekfytelyqqlndleacviqevgveetplmnedsilavrkyfqritlylt | aids000156 | 17:pn: wo0034317 figure: 11 unclaimed protein
List of Suppliers
Leap Chem Co., Ltd
Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production. Leap Chem Co., Ltd is supplier for Interferon alfa-2A. We are seller of 1-Benzyl-2-(difluoro(phenoxy)methyl)-4,5-dihydro-1H-imidazole.
LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities.
As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner.
Our client list includes many m ...
Country: P.R.China
Phone: +852-30606658
Telefax:
Most viewed
Within the past time user are also interested in the following chemicals.
Balsalazide disodium 2-hydrate
2-(4-Methylbenzyl)-2-(dimethylamino)-1-(4-morpholinophenyl)butan-1-one
Suppliers and manufactures - with identical CAS number as Interferon alfa-2A
For the following products supplier are listed below:
Roferon-a
The following companies are not suppliers of Interferon alfa-2A . This companies are suppliers for equal products with the same CAS number. CAS: 76543-88-9
Leap Chem Co., Ltd
Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production.
LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities.
As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. We are seller of 1-Benzyl-2-(difluoro(phenoxy)methyl)-4,5-dihydro-1H-imidazole.
Our client list includes many m ...
Country: P.R.China
Phone: +852-30606658
Telefax:
Related products:
|
|
|
How do you find
new customers?
click here
Nantong Baihua Bio-phar
We are a global supplier for pharmaceutical intermediates, fine chemicals, building blocks, rare co
Anderson Development Co
Anderson Development Company is an award winning specialty and custom chemical manufacturer with a
Autech Industry Co.,Lim
Autech Industry Co., Ltd was established in 2006, the head office is in Jinan City, Shandong Provin
Nation Ford Chemical Co
Founded in 1978, Nation Ford Chemical is one of America’s most respected custom and toll manufactur
M/s Pungar Valley Enter
Leading Manufacturers and Reliable Suppliers of High-Quality Soapstone and talcum powder.Pungar
FUDI Chemical Co. Ltd.
FUDI is an international chemical distributor.If you can't find it in our bulk catalog, we are
|
