|
|
|
Galanin (rat)
Synonyms: galanin(1-29)(rat,mouse) | gwtlnsagyllgphaidnhrsfsdkhglt-nh2 | galanin(pig), 23-l-serine-26-l-histidine-29-l-threoninamide- | l-threoninamide,glycyl-l-tryptophyl-l-threonyl-l-leucyl-l-asparaginyl-l-seryl-l-alanylglycyl-l-tyrosyl-l-leucyl-l-leucylglycyl-l-prolyl-l-histidyl-l-alanyl-l-isoleucyl-l-a-aspartyl-l-asparaginyl-l-histidyl-l-arginyl-l-seryl-l-phenylalanyl-l-seryl-l-a-aspartyl-l-lysyl-l-histidylglycyl-l-leucyl- | galanin (mouse) | rat galanin | galanin (mouse, rat) | 1-29-galanin (rat) | rat galanin-(1-29) | galanineã€rat】 | galanine(1-29)ã€rat】 | h-gly-trp-thr-leu-asn-ser-ala-gly-tyr-leu-leu-gly-pro-his-ala-ile-asp-asn-his-arg-ser-phe-ser-asp-lys-his-gly-leu-thr-nh2 | galanin (rat) (9ci) | gly-trp-thr-leu-asn-ser-ala-gly-tyr-leu-leu-gly-pro-his-ala-ile-asp-asn-his-arg-ser-phe-ser-asp-lys-his-gly-leu-thr-nh2 | galanin, rat
List of Suppliers
Skyrun Industrial Co., Ltd.
Company type: Leading producer
Skyrun Industrial Co.Limited, established in 2003, a state-controlled company (By Skyrun Corp. & High Hope) in China, specializing in developing, producing and handing raw pharmaceutical material and intermediates. Skyrun Industrial Co., Ltd. is supplier for Galanin (rat). We have expanded a compositive entity from initially only as a small manufacturer. S-(2-benzothiazolyl)-2-amino-alpha-(methoxyimino)-4-thiazole thioacetate is also served by Skyrun Industrial Co., Ltd.. We have extensive knowledge of domestic and international pharmaceutical markets. Our working range can be start from small amount in research stage to big bulk for industrial produc ...
Country: P.R.China
Phone: +86-576-84015261
Telefax: +86-576-84015261
BuGuCh & Partners
Company type: Analytical Institution
We, BuGuCh & Partners, are an international acting and innovative company, leading in developing and manufacturing.
We operates major facilities in North America, Europe and the Pacific Rim, as well as facilities in China, Japan and Saudi Arabia operated through joint ventures.
We maintain independently or are partners of some production sites in Europe, Asia and South America. BuGuCh & Partners is supplier for Galanin (rat). We are supplier of 4,5-Dicarboxy-gamma-pentadecanolactone. Our global network is a strength.
Our products range from natural gas, oil and basic chemi ...
Country: Germany
Phone:
Telefax:
Leap Chem Co., Ltd
Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production. We sell 5-Chloro-4-nitro-2,1,3-benzothiadiazole as well. Leap Chem Co., Ltd is supplier for Galanin (rat).
LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities.
As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner.
Our client list includes many m ...
Country: P.R.China
Phone: +852-30606658
Telefax:
Specification
Solubility: Soluble in water (1mg/ ml in 0.1% TFA)
Appearance: White lyophilized powder
Safety Information
Storage tempuraturx: -20°C
Most viewed
Within the past time user are also interested in the following chemicals.
Isosorbide exo monobenzoate ester
1-(2-Methoxyphenyl)propan-2-amine
Suppliers and manufactures - with identical CAS number as Galanin (rat)
For the following products supplier are listed below:
Rat galanin-(1-29)
Galanin (mouse, rat)
Hangzhou Dayangchem Co. Ltd.
Company type: Leading producer
Hangzhou DayangChem Co. Ltd is a comprehensive entity which specializes in development, production and trade of pharmaceutical, agrochemical and dyestuff intermediates as well as some special type reagents. We have an own factory and share enterprises. 6-Methyl-5-nitroquinoline will be also provided by us. We act also as agent of many chemical factories and promote their products to the international market at very competitive price.
We take "Credi first, Clients supreme" as our aim. We expect to cooperate with more partners ...
Country: P.R.China
Phone: +86-571-88938639
Telefax: +86-571-8893-8652
Bachem AG
Company type: Leading producer
About Bachem
Bachem is a listed technology-based company focused on peptide chemistry. The company provides a full range of services to the pharma and biotech industries. It specializes in the development of innovative, efficient manufacturing processes and the reliable production of peptide-based active pharmaceutical ingredients. We supply our chemical product Ac-Leu-Glu-His-Asp-AMC. A comprehensive catalog of biochemicals and exclusive custom syntheses for research labs complete the service portfolio. Headquartered in Swi ...
Country: Switzerland
Phone: +41 58 595 2021
Telefax: +41 58 595 2040
Related products:
|
|
|
How do you find
new customers?
click here
Neelkanth Polymers
We ´NEELKANTH POLYMERS, INDIA´ are the leading Manufacturer & Exporter of Guar Gum Products fro
Xiamen Zhongyuan Hongye
Xiamen Zhongyuan Hongye Chemical Co., Ltd. is committed to research and development, production and
Chengdu Pufeide Biotech
Chengdu Pufeide Biotech. Co., Ltd. is a leading supplier of natural pure plant monomers at home and
Tianjin Security Techno
Tianjin Security Technology Development Ltd Co. is a hi-tech enterprise with self-governed legal pe
ECSA Chemicals AG
Established in 1913 ECSA Chemicals has become one of the most important Swiss-owned distributors of
Hangzhou Proserre Chemi
Hangzhou Proserre Chemical Co., LTD established in Dec 2013 is a marketing, contract manufacturing,
|
