BGC Id: | 961613855527 | |
CAS No: | 95751-30-7 | |
Synonyms: | charybdotoxin (reduced),cyclic (7® ; charybdotoxin chtx ; charybdotoxin, recombinant, e coli ; m.w. 4295.89 c176h277n57o55s7 ; rchtx ; 33),(17® ; charybdotoxin ; 33,34,70,71,95,96-hexathia-2,5,8,11,14,17,20,23,26,29,37,40,43,46,49,52,55,58,61,64,67,74,77,80,83,86,89,92-octacosaazatricyclo[34.32.25.413,79]heptanonacontane,cyclic peptide deriv. ; 36: pn: wo2006116156 seqid: 36 claimed protein ; 35)-tris(disulfide) ; rcharybdotoxin ; chtx ; charybdotoxin, recombinant ; charybdotoxin, leiurus quinquestriatus hebraeus ; charybdotoxin (leiurus quinquestriatus hebraeus) ; 28),(13® ; pyr-ftnvscttskecwsvcqrlhntsrgkcmnkkcrcys | |
Molecular Formula: | C176H277 N57 O55 S7 | |
Molecular Weight: | 4295.89 | |
EINECS: |
BOC Sciences provides a wide range of customer services, bulk and specialty compounds to the pharmaceutical, agrochemical and biotechnology industries. We intend to offer you the products and services of the highest quality at the most reasonable, cost efficient prices. Most of our compounds can be supplied ranging from mg to kg and arrive with analytic report. BOC Sciences also offers Osimertinib D6. We hope to add immense value to your research projects! |
LEAPChem, a specialized fine chemicals supplier for research, development and production. LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities. As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. Our client list includes many major pharmac ... |
We, BuGuCh & Partners, are an international acting and innovative company, leading in developing and manufacturing. We operates major facilities in North America, Europe and the Pacific Rim, as well as facilities in China, Japan and Saudi Arabia operated through joint ventures. We maintain independently or are partners of some production sites in Europe, Asia and South America. Our global network is a strength. Our products range from natural gas, oil and basic chemi ... |