www.BuyersGuideChem.com - directory for chemicals and chemical suppliers
Productname:

BGC > Chemicals A-Z > CJC-1295

CJC-1295

Quick view: Suppliers
BGC Id:
705269156512
CAS No.:
Synonyms:
cjc1295 | cjc-1295 acetate | cjc1295 with out dac | y(d -a)daiftqsyrkvlaqlsarkllqdilsr-nh2 | l-tyrosyl-d-alanyl-l-alpha-aspartyl-l-alanyl-l-isoleucyl-l-phenylalanyl-l-threonyl-l-glutaminyl-l-seryl-l-tyrosyl-l-arginyl-l-lysyl-l-valyl-l-leucyl-l-alanyl-l-glutaminyl-l-seryl-l-alanyl-l-arginyl-l-lysyl-l-leucyl-l-leucyl-l-glutaminyl-l-alpha-aspartyl-l-isoleucyl-l-leucyl-l-seryl-l-arginyl-n6-[3-(2,5-dihydro-2,5-dioxo-1h-pyrrol-1-yl)-1-oxopropyl]-l-lysinamide
Formula:
C159H258N46O45

List of Suppliers

Alpha Biopharmaceuticals Co., Ltd.

Company type: Producer
Alabiochem company locates at a beautiful chinese city-SuZhou. Alpha Biopharmaceuticals Co., Ltd. is a seller of PACAP (1-38), human, ovine, rat. Alpha Biopharmaceuticals Co., Ltd. is supplier for CJC-1295. We are a professional biochemical company engaged in researching, developing, manufacturing pharmaceutical peptide、new amino acid, peptide synthetic technique and new type of peptide. Moreover, we are focused on nucleic acid and other small organic compounds. Alabiochem company not only provides contact research but custom synthesis service.
Country: P.R.China   Phone: +86-411-39042497   Telefax: +86-411-39042693

Hangzhou Zhongqi Chem Co., Ltd

Company type: Leading producer
Located in Hangzhou National Hi-Tech Industrial Development Zone, zhongqichem is a technical company mainly focus on the Custom synthesis, manufacturing, sales of chemicals to various industries. Hangzhou Zhongqi Chem Co., Ltd is supplier for CJC-1295. We supply our chemical product Acetanilide. Our advantage : 1.We do not simply provide chemicals , we provide chemical solutions and expertise; 2.We have trained, highly effective team to solve the problem at the first time; 3.Our QMS (quality management system) ensures the product quality strictly; 4.Stro ...
Country: P.R.China   Phone: +86-571-86976032   Telefax: +86-571-86972162

Hangzhou Keying Chem Co., Ltd.

Company type: Analytical Institution
Hangzhou Keying Chem Co., Ltd. Is a comprehensive enterprise, dedicated to the development, production and marketing of chemicals. As a technology innovative and service professional enterprise, Our company mainly engages in global pharmaceutical, chemical and biological service. Hangzhou Keying Chem Co., Ltd. is supplier for CJC-1295. Additionally (R)-(+)-2-Tetrahydrofuroic acid is supplied by us. After years of development, our company has accumulated abundant products resources in local China and international market which increasingly satisfy development requirements of customers. The p ...
Country: P.R.China   Phone: +86-571-85378921   Telefax: +86-571-85378913

Specification

Density:
1.45

Most viewed

Within the past time user are also interested in the following chemicals.
L-alpha-Glycerophosphoryl choline
Structure

Suppliers and manufactures - with identical CAS number as CJC-1295

For the following products supplier are listed below:
    CJC1295
    Cjc-1295(without dac)


The following companies are not suppliers of CJC-1295 . This companies are suppliers for equal products with the same CAS number. CAS: 863288-34-0


Supplier of

CJC1295

(CAS: 863288-34-0)

Conscientia Industrial Co., Ltd (Zhejiang Conscientia Pharmaceutical)

Company type: Producer
Conscientia Industrial Co., Ltd (Conscientia Pharm) mainly engages in developing, manufacturing, marketing, APIs (Active Pharmaceutical Ingredients), pharmaceutical intermediates. Tremella fuciformis polysaccharide will be also provided by us. Besides, we provide services of custom synthesis and contract manufacturing APIs (Active Pharmaceutical Ingredients), intermediates, fine chemicals for generic and new drugs. Conscientia Industrial aims to be world-class pharmaceutical raw materials supplier through unflagging efforts in quality, i ...
Country: P.R.China   Phone: +86 170 9858 0209   Telefax: +86 170 9858 0209

Hangzhou Meite Industry Co., Ltd (Hangzhou Meite Chemical Co., Ltd)

Company type: Producer
Hangzhou Meite Industry Co., Ltd. is an international high-tech enterprise founded in 1998, specialized in R&D and manufacture on intermediates, medicines, agrochemical, dyestuff, flavor, fragrance, cosmetic, natural extracts series products. We have an efficient R&D centre, get a strong technical support from Zhejiang University of Technology and Institute of Chemistry, Wuhan Branch, Chinese Academy of Sciences. We sell Sodium diethyldithiocarbamate 3-hydrate as well. Our factory Hangzhou Meite Chemical Co.,Ltd. is locat ...
Country: P.R.China   Phone: +86 571 88026825 / 88283817 / 88011063   Telefax: +86 571 88282557

Leap Chem Co., Ltd

Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production. LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities. As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. Leap Chem Co., Ltd also offers 3-Pyridinemethanol, 4-(4-fluoro-2-hydroxyphenyl)-a-methyl-2,6-bis(1-methylethyl)-5-propyl-, (aR,4R)-. Our client list includes many m ...
Country: P.R.China   Phone: +852-30606658   Telefax:

Amadis Chemical Company Limited

Company type: Leading producer
Amadis Chemical is one of the leading enterprises in medical and health products research,development,manufacture and trading.rnEstablished in 2010, Amadis Chemical are adhering to the " Consummate service Convincing honor " Business strategy. Amadis Chemical Company Limited is a seller of Ethyl 2,4-dibenzyloxy-3-formyl-6-methylbenzoate. The topping products and service we providing to you base on our strong technical accumulation and outstanding professional quality.rnOur associated labs, leading by the outstanding chemistry or pharmacy professors ,make us keep ...
Country: P.R.China   Phone: +86-571-89925085   Telefax: +86-571-89925065

Skyrun Industrial Co., Ltd.

Company type: Leading producer
Skyrun Industrial Co.Limited, established in 2003, a state-controlled company (By Skyrun Corp. We supply our chemical product Amides, tallow, hydrogenated. & High Hope) in China, specializing in developing, producing and handing raw pharmaceutical material and intermediates. We have expanded a compositive entity from initially only as a small manufacturer. We have extensive knowledge of domestic and international pharmaceutical markets. Our working range can be start from small amount in research stage to big bulk for industrial produc ...
Country: P.R.China   Phone: +86-576-84015261   Telefax: +86-576-84015261

Xingrui Industry Co., Limited

Company type: Leading producer
Xingrui Industry CO., LTD. is a professional manufacturing enterprise integrating R&D, production and sales. Xingrui Industry Co., Limited is a seller of . The products involved fine chemicals, pharmaceutical intermediates, dye intermediates, cosmetic raw materials and so on. The company is ranked among the outstanding producers in the fine chemical industry. Xingrui Industry always strive to be the most reliable partner of our customers, and strive to build a customer-trusted, socially respected, world-class fi ...
Country: P.R.China   Phone: +86-531-88980365   Telefax: +86-531-88980365

Supplier of

Cjc-1295(without dac)

(CAS: 863288-34-0)

BOC Sciences

Company type: Supplier
BOC Sciences provides a wide range of customer services, bulk and specialty compounds to the pharmaceutical, agrochemical and biotechnology industries. We sell as well. We intend to offer you the products and services of the highest quality at the most reasonable, cost efficient prices. Most of our compounds can be supplied ranging from mg to kg and arrive with analytic report. We hope to add immense value to your research projects!
Country: USA   Phone: +1-631-485-4226   Telefax: +1-631-614-7828

Shandong Ench Chemical Co.,Ltd

Company type: Producer
Shandong Ench Chemical Co.Ltd is a professional manufacturers and supplier in the world ,the main product include chemical pharmaceuticals and intermediates, food and feed additives, herbal extracts, agrochemicals and fine chemicals etc. It is a privet-owned enterprise and located in Zhangqiu industrial park, We believe that quality is the life of our company. We are seller of . We manufacture our products in strict accordance with ISO9001: 2000 quality management system during the whole en ...
Country: P.R.China   Phone: +86-13869131854   Telefax: +86 531-8637666

polypeptide.ltd

Company type: Laboratory supplier
Xuchang Shangke Chemical Co., Ltd. (Phcoker / Polypeptide.ltd) was founded in 2008, located in the Fine Chemical Industrial Park of Zhangpan Town, Xuchang, Henan Province, with 10 million square meters, total assets of 10 million US dollars, and more than 100 employees. Shangke Chemical is a high-tech enterprise specializing in active pharmaceutical intermediates (APIs). We provide Plecanatide as well. To control the quality during production, a large number of experienced professionals, a first-class pr ...
Country: P.R.China   Phone: +86 152 1950 7320   Telefax:

AASraw

Company type: Bulk chemical producer
AASraw aims to be the most trusted CDMO of API in the world! AASraw is the professional manufacturer which has independent lab and large factory as support, all production will be carried out under CGMP regulation and trackable quality control system. is also served by AASraw. The supply system is stable, both retail and wholesale orders are acceptable.Welcome to order from AASraw!
Country: P.R.China   Phone: +86 18824303959   Telefax:


Language:
english português français deutsch español
svensk norsk italiano 中国 日本語 по-русски




How do you find
new customers?

click here


New Natural Biotechnolo
New Natural is a Developer, Manufacturer, Exporter and Supplier of herbal extracts. We specialize i


Cure Biochem
Cure BioChem is a fully integrated biotechnology R&D, manufacturing and marketing Biopolymer Pr


Nagaad Resins and Gums
Nagaad Gums and Resins (Nagaad Gums) is a community based social enterprise company dealing in the


Alpha Biopharmaceutical
Alabiochem company locates at a beautiful chinese city-SuZhou. We are a professional biochemical co


Shandong SanYoung Indus
Shandong SanYoung Industry Co., Ltd is a scientific and technological company specializing in resea


JieJie Group Co., Ltd.
Shanghai JieJie Chemical Co., Ltd is a pharmaceutical and chemical enterprise for the research and


© Copyright 1996 to 2024 by Netvertise GmbH. All rights reserved CJC-1295