|
|
|
(D-Ala2)-GRF (1-29) amide (human)
Synonyms: (d-ala2)-grf (1-29) amide (human)
(d-ala2)-sermorelin | [d-ala2]-humangrowth hormone-releasing factor-(1-29)nh2 | growth hormone releasing factor (d-ala2)-fragment 1-29 amide human | [dala2] ghrf (1-29), amide, human | (d-ala2)-sermorelin | (d-ala2)-growth hormone-releasing factor (1-29) amide (human) | (d-ala2)-grf (1-29) amide (human) | 1-29-somatoliberin(human pancreatic islet), 2-d-alanine-29-l-argininamide- (9ci) | somatoliberin(human pancreatic islet),2-d-alanine-29-l-argininamide-30-de-l-glutamine-31-de-l-glutamine-32-deglycine-33-de-l-glutamicacid-34-de-l-serine-35-de-l-asparagine-36-de-l-glutamine-37-de-l-glutamicacid-38-de-l-arginine-39-deglycine-40-de-l-alanine-41-de-l-arginine-42-de-l-alanine-43-de-l-arginine-44-de-l-leucinamide- | tyr-d-ala-asp-ala-ile-phe-thr-asn-ser-tyr-arg-lys-val-leu-gly-gln-leu-ser-ala-arg-lys-leu-leu-gln-asp-ile-met-ser-arg-nh2 | yadaiftnsyrkvlgqlsarkllqdimsr-nh2 | h-tyr-d-ala-asp-ala-ile-phe-thr-asn-ser-tyr-arg-lys-val-leu-gly-gln-leu-ser-ala-arg-lys-leu-leu-gln-asp-ile-met-ser-arg-nh2 | somatoliberin fragment 1-29 amide, [d-ala2], human | 1-29-[d-ala2]-human growth hormone-releasing factor amide
Formula: C149H246 N44 O42 S
List of Suppliers
Bachem AG
Company type: Leading producer
About Bachem
Bachem is a listed technology-based company focused on peptide chemistry. The company provides a full range of services to the pharma and biotech industries. Bachem AG is supplier for (D-Ala2)-GRF (1-29) amide (human). It specializes in the development of innovative, efficient manufacturing processes and the reliable production of peptide-based active pharmaceutical ingredients. We are seller of H-D-Val-Leu-Lys-AMC. A comprehensive catalog of biochemicals and exclusive custom syntheses for research labs complete the service portfolio. Headquartered in Swi ...
Country: Switzerland
Phone: +41 58 595 2021
Telefax: +41 58 595 2040
BuGuCh & Partners
Company type: Analytical Institution
We, BuGuCh & Partners, are an international acting and innovative company, leading in developing and manufacturing.
We operates major facilities in North America, Europe and the Pacific Rim, as well as facilities in China, Japan and Saudi Arabia operated through joint ventures.
We maintain independently or are partners of some production sites in Europe, Asia and South America. BuGuCh & Partners is supplier for (D-Ala2)-GRF (1-29) amide (human). We are supplier of 3-Methylisonicotinic acid. Our global network is a strength.
Our products range from natural gas, oil and basic chemi ...
Country: Germany
Phone:
Telefax:
Leap Chem Co., Ltd
Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production. We sell 4-(2-(Methoxycarbonyl)thiophen-3-yl)benzoic acid as well.
LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities.
As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. Leap Chem Co., Ltd is supplier for (D-Ala2)-GRF (1-29) amide (human).
Our client list includes many m ...
Country: P.R.China
Phone: +852-30606658
Telefax:
Safety Information
Storage tempuraturx: -15°C
Most viewed
Within the past time user are also interested in the following chemicals.
Related products:
|
|
|
How do you find
new customers?
click here
Jinan Honestpharm Co.,
Jinan Honestpharm Co., Ltd is a leading global supplier of advanced intermediates and laboratory ch
Lori Industry Co., Ltd
Lori industry Co., Ltd was established in 2002 years. It is a large-scale manufacturer integrating
Jiangsu Kolod Food Ingr
Jiangsu Kolod Food Ingredients Co., Ltd. is a professional manufacturer of phosphates, citrates, ch
Nagaad Resins and Gums
Nagaad Gums and Resins (Nagaad Gums) is a community based social enterprise company dealing in the
PeptART Bioscience GmbH
PeptART Bioscience GmbH is a 100% Swiss company with its own manufacturing facilities in Switzerlan
Wuhan Biet Co., Ltd.
WUHAN BIET CO.,LTD was set up in July 2010.It specializes in theproduction,research,development and
|
