|
|
|
Helodermin
Synonyms: helodermin | 4: pn: wo0234285 seqid: 12 claimedprotein | vasoactive intestinal peptide-phi like peptide | helodermin (heloderma suspectum) | helodormin | hsdaiftqqyskllaklalqkylasilgsrtsppp | l-prolinamide, l-histidyl-l-seryl-l-a-aspartyl-l-alanyl-l-isoleucyl-l-phenylalanyl-l-threonyl-l-glutaminyl-l-glutaminyl-l-tyrosyl-l-seryl-l-lysyl-l-leucyl-l-leucyl-l-alanyl-l-lysyl-l-leucyl-l-alanyl-l-leucyl-l-glutaminyl-l-lysyl-l-tyrosyl-l-leucyl-l-alanyl-l-seryl-l-isoleucyl-l-leucylglycyl-l-seryl-l-arginyl-l-threonyl-l-seryl-l-prolyl-l-prolyl- | heliodermin | h-his-ser-asp-ala-ile-phe-thr-glu-glu-tyr-ser-lys-leu-leu-ala-lys-ala-leu-gln-lys-tyr-leu-ala-ser-ile-leu-gly-ser-arg-thr-ser-pro-pro-pro-nh2 | vip-phi like peptide | his-ser-asp-ala-ile-phe-thr-gln-gln-tyr-ser-lys-leu-leu-ala-lys-leu-ala-leu-gln-lys-tyr-leu-ala-ser-ile-leu-gly-ser-arg-thr-ser-pro-pro-pro-nh2 | helospectini,5-l-isoleucine-8-l-glutamine-9-l-glutamine-24-l-alanine-30-l-arginine-34-de-l-arginine-36-l-prolinamide-37-de-l-serine-38-de-l-serine- | 32: pn: wo0179539 seqid: 25 claimed protein | hsdaiftgeyskllaklalqkylasilgsrtsppp-nh2 | helodermin (9ci)
List of Suppliers
Bachem AG
Company type: Leading producer
About Bachem
Bachem is a listed technology-based company focused on peptide chemistry. The company provides a full range of services to the pharma and biotech industries. It specializes in the development of innovative, efficient manufacturing processes and the reliable production of peptide-based active pharmaceutical ingredients. We supply our chemical product H-Arg-Ser-Arg-His-Phe-OH. Bachem AG is supplier for Helodermin. A comprehensive catalog of biochemicals and exclusive custom syntheses for research labs complete the service portfolio. Headquartered in Swi ...
Country: Switzerland
Phone: +41 58 595 2021
Telefax: +41 58 595 2040
Leap Chem Co., Ltd
Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production.
LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities.
As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. Leap Chem Co., Ltd is supplier for Helodermin. We supply our chemical product 3-Ethyl-3-(3-hydroxyphenyl)-1-propylpiperidine hydrobromide.
Our client list includes many m ...
Country: P.R.China
Phone: +852-30606658
Telefax:
Safety Information
Storage tempuraturx: -20°C
Most viewed
Within the past time user are also interested in the following chemicals.
Related products:
|
|
|
How do you find
new customers?
click here
Qingdao QY Liquid Cryst
15 years of PDLC liquid crystal production experience. Qingdao QY Liquid Crystal Co., Ltd. is a pr
Nvichem co.
Novichem is an innovative, customer oriented, globally active importer - exporter and supplier of C
LANDMARK Industrial Co.
Wuhan LANDMARK Industrial Co., Ltd. was established in 2012. The company specializes in the researc
Jiangsu Tetra New Mater
Tetrachem is a high-tech company specialized in R&D, production, sales and technical service of
Nantong Zandery Biotech
Nantong Zandery Bio Technology Co., Ltd. was established in May 2018. It is located in Rugao Port N
FUDI Chemical Co. Ltd.
FUDI is an international chemical distributor.If you can't find it in our bulk catalog, we are
|
