|
|
|
Helodermin
Synonyms: helodermin | 4: pn: wo0234285 seqid: 12 claimedprotein | vasoactive intestinal peptide-phi like peptide | helodermin (heloderma suspectum) | helodormin | hsdaiftqqyskllaklalqkylasilgsrtsppp | l-prolinamide, l-histidyl-l-seryl-l-a-aspartyl-l-alanyl-l-isoleucyl-l-phenylalanyl-l-threonyl-l-glutaminyl-l-glutaminyl-l-tyrosyl-l-seryl-l-lysyl-l-leucyl-l-leucyl-l-alanyl-l-lysyl-l-leucyl-l-alanyl-l-leucyl-l-glutaminyl-l-lysyl-l-tyrosyl-l-leucyl-l-alanyl-l-seryl-l-isoleucyl-l-leucylglycyl-l-seryl-l-arginyl-l-threonyl-l-seryl-l-prolyl-l-prolyl- | heliodermin | h-his-ser-asp-ala-ile-phe-thr-glu-glu-tyr-ser-lys-leu-leu-ala-lys-ala-leu-gln-lys-tyr-leu-ala-ser-ile-leu-gly-ser-arg-thr-ser-pro-pro-pro-nh2 | vip-phi like peptide | his-ser-asp-ala-ile-phe-thr-gln-gln-tyr-ser-lys-leu-leu-ala-lys-leu-ala-leu-gln-lys-tyr-leu-ala-ser-ile-leu-gly-ser-arg-thr-ser-pro-pro-pro-nh2 | helospectini,5-l-isoleucine-8-l-glutamine-9-l-glutamine-24-l-alanine-30-l-arginine-34-de-l-arginine-36-l-prolinamide-37-de-l-serine-38-de-l-serine- | 32: pn: wo0179539 seqid: 25 claimed protein | hsdaiftgeyskllaklalqkylasilgsrtsppp-nh2 | helodermin (9ci)
List of Suppliers
Bachem AG
Company type: Leading producer
About Bachem
Bachem is a listed technology-based company focused on peptide chemistry. The company provides a full range of services to the pharma and biotech industries. It specializes in the development of innovative, efficient manufacturing processes and the reliable production of peptide-based active pharmaceutical ingredients. We supply our chemical product H-Arg-Ser-Arg-His-Phe-OH. Bachem AG is supplier for Helodermin. A comprehensive catalog of biochemicals and exclusive custom syntheses for research labs complete the service portfolio. Headquartered in Swi ...
Country: Switzerland
Phone: +41 58 595 2021
Telefax: +41 58 595 2040
Leap Chem Co., Ltd
Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production.
LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities.
As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. Leap Chem Co., Ltd is supplier for Helodermin. We supply our chemical product 3-Ethyl-3-(3-hydroxyphenyl)-1-propylpiperidine hydrobromide.
Our client list includes many m ...
Country: P.R.China
Phone: +852-30606658
Telefax:
Safety Information
Storage tempuraturx: -20°C
Most viewed
Within the past time user are also interested in the following chemicals.
Related products:
|
|
|
How do you find
new customers?
click here
Cure Biochem
Cure BioChem is a fully integrated biotechnology R&D, manufacturing and marketing Biopolymer Pr
Anhui Chufeng Medical T
Chufeng was established in 2020, located in Innovation Industrial Park in Hefei High-tech district,
Tianjin Security Techno
Tianjin Security Technology Development Ltd Co. is a hi-tech enterprise with self-governed legal pe
Shandong Shimizu Chemic
Japan-China Joint Venture enterprise, mainly produce Dimethyl Isophthalate and polymerizable esters
Giga Fine Chem.
Giga Fine Chem. is over 40 years history and headquarters in Taipei. Main business is to do the fun
United New Materials Te
UMT focuse to research and produce high purity chemical and materials for application of food, phar
|
