www.BuyersGuideChem.com - directory for chemicals and chemical suppliers
Productname:

BGC > Chemicals A-Z > GRF (porcine)

GRF (porcine)

Quick view: Suppliers
BGC Id:
643093117594
CAS No.:
Synonyms:
ghrf, porcine | grf (1-44) (porcine) | somatoliberin, porcine | grf (1-44), amide, porcine | growth hormone releasing factor porcine | growth hormone-releasing factor (1-44) (porcine) | yadaiftnsyrkvlgqlsarkllqdimsrqqgernqeqgarvrl-nh2 | growth hormone releasing factor (1-44), amide, porcine | somatocrinin (porcine), somatoliberin (porcine), growth hormone-releasing factor (porcine), ghrh (porcine), growth hormone-releasing hormone (porcine) | grf (porcine) somatocrinin (porcine), somatoliberin (porcine), growth hormone-releasing factor (porcine), ghrh (porcine), growth hormone-releasing hormone (porcine) | somatoliberin(human pancreatic islet), 34-l-arginine-38-l-glutamine-42-l-valine- | somatoliberin(pig hypothalamus) | l-leucinamide, l-tyrosyl-l-alanyl-l-a-aspartyl-l-alanyl-l-isoleucyl-l-phenylalanyl-l-threonyl-l-asparaginyl-l-seryl-l-tyrosyl-l-arginyl-l-lysyl-l-valyl-l-leucylglycyl-l-glutaminyl-l-leucyl-l-seryl-l-alanyl-l-arginyl-l-lysyl-l-leucyl-l-leucyl-l-glutaminyl-l-a-aspartyl-l-isoleucyl-l-methionyl-l-seryl-l-arginyl-l-glutaminyl-l-glutaminylglycyl-l-a-glutamyl-l-arginyl-l-asparaginyl-l-glutaminyl-l-a-glutamyl-l-glutaminylglycyl-l-alanyl-l-arginyl-l-valyl-l-arginyl- | somatoliberin (swinehypothalamus) (9ci)
Formula:
C219H365 N73 O66 S
Molecular Weight:
5108.76

List of Suppliers

Bachem AG

Company type: Leading producer
About Bachem Bachem is a listed technology-based company focused on peptide chemistry. H-D-Glu(OBzl)-OBzl p-tosylate will be also provided by us. The company provides a full range of services to the pharma and biotech industries. Bachem AG is supplier for GRF (porcine). It specializes in the development of innovative, efficient manufacturing processes and the reliable production of peptide-based active pharmaceutical ingredients. A comprehensive catalog of biochemicals and exclusive custom syntheses for research labs complete the service portfolio. Headquartered in Swi ...
Country: Switzerland   Phone: +41 58 595 2021   Telefax: +41 58 595 2040

Safety Information

WGK Germany:
3
Storage tempuraturx:
-20°C

Most viewed

Within the past time user are also interested in the following chemicals.

Suppliers and manufactures - with identical CAS number as GRF (porcine)

For the following products supplier are listed below:
    GRF (1-44) (porcine)


The following companies are not suppliers of GRF (porcine) . This companies are suppliers for equal products with the same CAS number. CAS: 88384-73-0


Supplier of

GRF (1-44) (porcine)

(CAS: 88384-73-0)

Leap Chem Co., Ltd

Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production. LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities. As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. We sell Benzene, 1-ethyl-4-methyl-2-(1-methylethyl)- as well. Our client list includes many m ...
Country: P.R.China   Phone: +852-30606658   Telefax:


Related products:


Language:
english português français deutsch español
svensk norsk italiano 中国 日本語 по-русски




How do you find
new customers?

click here


BioClot GmbH
BioClot is a leading manufacturer and distributor specialising in quality Animal Blood Serum and re


Meryer (Shanghai) Chemi
Our products cover organic, inorganic, analytical and biochemical reagents including pharmaceutical


Fan Avaran Shimi
We are the leading manufacturers of Metal Stearates in Iran (Calcium Stearate, Zinc Stearate, Magne


ECSA Chemicals AG
Established in 1913 ECSA Chemicals has become one of the most important Swiss-owned distributors of


Nanjing Fred Technology
Nanjing Fred technology Co., Ltd. is a high-tech enterprise engaged in the R&D, production and


Mayue Longteng Technolo
Founded in 2016, Mayue Longteng Technology Co., Ltd. is located in Wuhan City of Hubei Province; re


© Copyright 1996 to 2024 by Netvertise GmbH. All rights reserved GRF (porcine)