|
|
Galanin (porcine)
Synonyms: galanin (pig) | gwtlnsagyllgphaidnhrsfhdkygla-nh2 | porcine galanin | gly-trp-thr-leu-asn-ser-ala-gly-tyr-leu-leu-gly-pro-his-ala-lle-asp-asn-his-arg-ser-phe-his-asp-lys-tyr-gly-leu-ala-nh2 | l-alaninamide,glycyl-l-tryptophyl-l-threonyl-l-leucyl-l-asparaginyl-l-seryl-l-alanylglycyl-l-tyrosyl-l-leucyl-l-leucylglycyl-l-prolyl-l-histidyl-l-alanyl-l-isoleucyl-l-a-aspartyl-l-asparaginyl-l-histidyl-l-arginyl-l-seryl-l-phenylalanyl-l-histidyl-l-a-aspartyl-l-lysyl-l-tyrosylglycyl-l-leucyl- | galanin(1-29) porcine | porcine galanin(1-29) | ccris 6750 | galanin, porcine | galanin | pig galanin | galanin(pig) | galanin (swine)
List of Suppliers
Bachem AG
Company type: Leading producer
About Bachem
Bachem is a listed technology-based company focused on peptide chemistry. The company provides a full range of services to the pharma and biotech industries. Bachem AG is supplier for Galanin (porcine). It specializes in the development of innovative, efficient manufacturing processes and the reliable production of peptide-based active pharmaceutical ingredients. A comprehensive catalog of biochemicals and exclusive custom syntheses for research labs complete the service portfolio. We sell H-Glu(His-OH)-OH as well. Headquartered in Swi ...
Country: Switzerland
Phone: +41 58 595 2021
Telefax: +41 58 595 2040
Chemos GmbH & Co. KG
Company type: Supplier of chemical products
Chemos is a leading supplier of chemical specialties for your research and production needs. Chemos GmbH & Co. KG is supplier for Galanin (porcine). Everything new starts small and needs specific support during scale up and production. Chemos GmbH & Co. KG also offers 8-Fluoro-4-hydroxyquinoline-3-carboxylic acid. With over 25 years of experience in the fine chemical market Chemos is supporting research institutions and chemical companies in Europe and America. Chemos is a sourcing and distribution company with a grown and strong network of custom manufacturing companies and chemical producers from around the ...
Country: Germany
Phone: +49-871-966346-0
Telefax: +49-871-966346-13
BuGuCh & Partners
Company type: Analytical Institution
We, BuGuCh & Partners, are an international acting and innovative company, leading in developing and manufacturing.
We operates major facilities in North America, Europe and the Pacific Rim, as well as facilities in China, Japan and Saudi Arabia operated through joint ventures.
We maintain independently or are partners of some production sites in Europe, Asia and South America. BuGuCh & Partners is supplier for Galanin (porcine). We sell 1,1-Cyclohexanediacetimide as well. Our global network is a strength.
Our products range from natural gas, oil and basic chemi ...
Country: Germany
Phone:
Telefax:
Leap Chem Co., Ltd
Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production. Leap Chem Co., Ltd also offers 6-[(2-Fluoroanilino)carbonyl]-3-cyclohexene-1-carboxylic acid.
LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities.
As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. Leap Chem Co., Ltd is supplier for Galanin (porcine).
Our client list includes many m ...
Country: P.R.China
Phone: +852-30606658
Telefax:
Safety Information
Storage tempuraturx: -20°C
Most viewed
Within the past time user are also interested in the following chemicals.
N-(4-Aminobenzoyl)-beta-alanine
Hydroxypropylmethylcellulose (HMPC)
Suppliers and manufactures - with identical CAS number as Galanin (porcine)
For the following products supplier are listed below:
Porcine galanin(1-29)
Hangzhou Dayangchem Co. Ltd.
Company type: Leading producer
Hangzhou DayangChem Co. Ltd is a comprehensive entity which specializes in development, production and trade of pharmaceutical, agrochemical and dyestuff intermediates as well as some special type reagents. We have an own factory and share enterprises. We supply our chemical product Octahydro-pyrrolo[1,2-a]pyrazine. We act also as agent of many chemical factories and promote their products to the international market at very competitive price.
We take "Credi first, Clients supreme" as our aim. We expect to cooperate with more partners ...
Country: P.R.China
Phone: +86-571-88938639
Telefax: +86-571-8893-8652
Related products:
|
|
|
How do you find new customers?
click here
Hangzhou Cherry Pharmac
Hangzhou Cherry Pharmaceutical Technology Co., LTD is a marketing company from China engaged in pha
Neelkanth Polymers
We ´NEELKANTH POLYMERS, INDIA´ are the leading Manufacturer & Exporter of Guar Gum Products fro
Nation Ford Chemical Co
Founded in 1978, Nation Ford Chemical is one of America’s most respected custom and toll manufactur
BuGuCh & Partners
We, BuGuCh & Partners, are an international acting and innovative company, leading in developin
Alpha Biopharmaceutical
Alabiochem company locates at a beautiful chinese city-SuZhou. We are a professional biochemical co
Nanjing Shunxiang Pharm
Shunxiang is a comprehensive company specializing in the development, production and marketing of n
|