|
|
|
Urocortin III (mouse)
Synonyms: stresscopin (mouse) | ucn iii (mouse) trifluoroacetate salt | urocortin iii (mouse) trifluoroacetate salt | urocortiniii (mouse) | urocortin ii (mouse) | urocortin iii (mouse) | l-isoleucinamide,l-phenylalanyl-l-threonyl-l-leucyl-l-seryl-l-leucyl-l-a-aspartyl-l-valyl-l-prolyl-l-threonyl-l-asparaginyl-l-isoleucyl-l-methionyl-l-asparaginyl-l-isoleucyl-l-leucyl-l-phenylalanyl-l-asparaginyl-l-isoleucyl-l-a-aspartyl-l-lysyl-l-alanyl-l-lysyl-l-asparaginyl-l-leucyl-l-arginyl-l-alanyl-l-lysyl-l-alanyl-l-alanyl-l-alanyl-l-asparaginyl-l-alanyl-l-glutaminyl-l-leucyl-l-methionyl-l-alanyl-l-glutaminyl- | ucn-ii | mouse urocortiniii | ftlsldvptnimnilfnidkaknlrakaaanaqlmaqi-nh2 | scp (3-40) (mouse) trifluoroacetate salt | ucn-ii mouse | scp (3-40) (mouse) | stresscopin (3-40) (mouse) trifluoroacetate salt | mouseurocortin 3
Formula: C186H312 N52 O52 S2
List of Suppliers
Bachem AG
Company type: Leading producer
About Bachem
Bachem is a listed technology-based company focused on peptide chemistry. The company provides a full range of services to the pharma and biotech industries. Bachem AG is supplier for Urocortin III (mouse). It specializes in the development of innovative, efficient manufacturing processes and the reliable production of peptide-based active pharmaceutical ingredients. A comprehensive catalog of biochemicals and exclusive custom syntheses for research labs complete the service portfolio. We provide Kisspeptin-54 (27-54) (human) as well. Headquartered in Swi ...
Country: Switzerland
Phone: +41 58 595 2021
Telefax: +41 58 595 2040
Safety Information
Storage tempuraturx: -20°C
Most viewed
Within the past time user are also interested in the following chemicals.
Suppliers and manufactures - with identical CAS number as Urocortin III (mouse)
For the following products supplier are listed below:
FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2
The following companies are not suppliers of Urocortin III (mouse) . This companies are suppliers for equal products with the same CAS number. CAS: 357952-10-4
Leap Chem Co., Ltd
Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production. Additionally α-nitrostyrene is supplied by us.
LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities.
As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner.
Our client list includes many m ...
Country: P.R.China
Phone: +852-30606658
Telefax:
Related products:
|
|
|
How do you find
new customers?
click here
Vistachem Europe GmbH
As reliable providers of chemicals from across the globe, our world-wide web sources and supplies t
Chemtour Biotech Co., L
Founded in 2014, Chemtour is specializing in providing pharmaceutical raw materials and chemicals f
ReseaChem
Service laboratory focused on analytics and synthesis.Only laboratory in Switzerland with guaran
Shouguang Nuomeng Chemi
Shouguang Nuomeng Chemical Co., Ltd., established in 2008, is located in Houzhen Industrial Park of
Wuhan Monad Medicine Te
Wuhan Monad Medicine Tech Co.,LTD was established in 2016.，is a high-tech innovative enterprise spe
Shree Gayatri Chemicals
Manufacturing company of drug intermediate and organic chemicals.Shree Gayatri Chemicals
|
