|
|
Pancreatic polypeptide, human
Synonyms: pp, human | ala-pro-leu-glu-pro-val-tyr-pro-gly-asp-asn-ala-thr-pro-glu-gln-met-ala-gln-tyr-ala-ala-asp-leu-arg-arg-tyr-ile-asn-met-leu-thr-arg-pro-arg-tyr-nh2 human | aplepvypgdnatpeqmaqyaadlrryinmltrpry-nh2 | ala-pro-leu-glu-pro-val-tyr-pro-gly-asp-asn-ala-thr-pro-glu-gln-met-ala-gln-met-ala-gln-tyr-ala-ala-asp-leu-arg-arg-tyr-ile-asn-met-leu-thr-arg-pro-arg-tyr-nh2 | pancreatichormone iii | pancreatic polypeptide, human synthetic >99% | fbavian ::fn | ala-pro-leu-glu-pro-val-tyr-pro-gly-asp-asn-ala-thr-pro-glu-gln-met-ala-gln-tyr-ala-ala-asp-leu-arg-arg-tyr-ile-asn-met-leu-thr-arg-pro-arg-tyr-nh2 | h-ala-pro-leu-glu-pro-val-tyr-pro-gly-asp-asn-ala-thr-pro-glu-gln-met-ala-gln-tyr-ala-ala-asp-leu-arg-arg-tyr-ile-asn-met-leu-thr-arg-pro-arg-tyr-nh2 | pancreatic polypeptide, human | pancreatic polypeptide
Molecular Weight: 444.5205
List of Suppliers
Leap Chem Co., Ltd
Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production. Leap Chem Co., Ltd is a seller of 5-Chloro-2,4-difluoro-benzoic acid methyl ester.
LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities.
As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. Leap Chem Co., Ltd is supplier for Pancreatic polypeptide, human.
Our client list includes many m ...
Country: P.R.China
Phone: +852-30606658
Telefax:
Specification
Boiling Point: 612.8 °C at 760 mmHg
Safety Information
Storage tempuraturx: -20 °C
Most viewed
Within the past time user are also interested in the following chemicals.
Tributoxy ethyl phosphate
Suppliers and manufactures - with identical CAS number as Pancreatic polypeptide, human
For the following products supplier are listed below:
Pancreatic polypeptide (human)
The following companies are not suppliers of Pancreatic polypeptide, human . This companies are suppliers for equal products with the same CAS number. CAS: 59763-91-6
BuGuCh & Partners
Company type: Analytical Institution
We, BuGuCh & Partners, are an international acting and innovative company, leading in developing and manufacturing.
We operates major facilities in North America, Europe and the Pacific Rim, as well as facilities in China, Japan and Saudi Arabia operated through joint ventures.
We maintain independently or are partners of some production sites in Europe, Asia and South America. We provide 3,5-Dichlorophenethyl alcohol as well. Our global network is a strength.
Our products range from natural gas, oil and basic chemi ...
Country: Germany
Phone:
Telefax:
|
|
|
How do you find new customers?
click here
Akzo Nobel Functional C
AkzoNobel continues to develop its position as the global leader in MCA with interregional supply c
Nantong Zandery Biotech
Nantong Zandery Bio Technology Co., Ltd. was established in May 2018. It is located in Rugao Port N
Zhengzhou Key-chemi Bio
Zhengzhou Key-chemi biotechnology co., LTD. is a high-tech company committed to the field of chemic
Xperio Impex
Xperio Impex is a global supplier of specialty & industrial chemicals based in New Delhi, India
Qingdao QY Liquid Cryst
15 years of PDLC liquid crystal production experience. Qingdao QY Liquid Crystal Co., Ltd. is a pr
Laizhou Jinxing Chemica
LAIZHOU JINXING CHEMICAL CO., LTD. is the largest manufacturer of Sulfamic Acid in north China.
|