|
|
Helodermin
Synonyms: helodermin | 4: pn: wo0234285 seqid: 12 claimedprotein | vasoactive intestinal peptide-phi like peptide | helodermin (heloderma suspectum) | helodormin | hsdaiftqqyskllaklalqkylasilgsrtsppp | l-prolinamide, l-histidyl-l-seryl-l-a-aspartyl-l-alanyl-l-isoleucyl-l-phenylalanyl-l-threonyl-l-glutaminyl-l-glutaminyl-l-tyrosyl-l-seryl-l-lysyl-l-leucyl-l-leucyl-l-alanyl-l-lysyl-l-leucyl-l-alanyl-l-leucyl-l-glutaminyl-l-lysyl-l-tyrosyl-l-leucyl-l-alanyl-l-seryl-l-isoleucyl-l-leucylglycyl-l-seryl-l-arginyl-l-threonyl-l-seryl-l-prolyl-l-prolyl- | heliodermin | h-his-ser-asp-ala-ile-phe-thr-glu-glu-tyr-ser-lys-leu-leu-ala-lys-ala-leu-gln-lys-tyr-leu-ala-ser-ile-leu-gly-ser-arg-thr-ser-pro-pro-pro-nh2 | vip-phi like peptide | his-ser-asp-ala-ile-phe-thr-gln-gln-tyr-ser-lys-leu-leu-ala-lys-leu-ala-leu-gln-lys-tyr-leu-ala-ser-ile-leu-gly-ser-arg-thr-ser-pro-pro-pro-nh2 | helospectini,5-l-isoleucine-8-l-glutamine-9-l-glutamine-24-l-alanine-30-l-arginine-34-de-l-arginine-36-l-prolinamide-37-de-l-serine-38-de-l-serine- | 32: pn: wo0179539 seqid: 25 claimed protein | hsdaiftgeyskllaklalqkylasilgsrtsppp-nh2 | helodermin (9ci)
List of Suppliers
Bachem AG
Company type: Leading producer
About Bachem
Bachem is a listed technology-based company focused on peptide chemistry. The company provides a full range of services to the pharma and biotech industries. It specializes in the development of innovative, efficient manufacturing processes and the reliable production of peptide-based active pharmaceutical ingredients. We supply our chemical product H-Arg-Ser-Arg-His-Phe-OH. Bachem AG is supplier for Helodermin. A comprehensive catalog of biochemicals and exclusive custom syntheses for research labs complete the service portfolio. Headquartered in Swi ...
Country: Switzerland
Phone: +41 58 595 2021
Telefax: +41 58 595 2040
Leap Chem Co., Ltd
Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production.
LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities.
As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. Leap Chem Co., Ltd is supplier for Helodermin. We supply our chemical product 3-Ethyl-3-(3-hydroxyphenyl)-1-propylpiperidine hydrobromide.
Our client list includes many m ...
Country: P.R.China
Phone: +852-30606658
Telefax:
Safety Information
Storage tempuraturx: -20°C
Most viewed
Within the past time user are also interested in the following chemicals.
Related products:
|
|
|
How do you find new customers?
click here
LANDMARK Industrial Co.
Wuhan LANDMARK Industrial Co., Ltd. was established in 2012. The company specializes in the researc
Rieke Metals LLC
Rieke Metals Inc. (RMI) began in 1991 with its foundation in over 40 years of research in active me
Mayue Longteng Technolo
Founded in 2016, Mayue Longteng Technology Co., Ltd. is located in Wuhan City of Hubei Province; re
Shandong Shimizu Chemic
Japan-China Joint Venture enterprise, mainly produce Dimethyl Isophthalate and polymerizable esters
Anhui Royal Chemical Co
Anhui Royal Chemical Co., Ltd. was founded in 2008. Since our foundation, we have been devoted to t
Lori Industry Co., Ltd
Lori industry Co., Ltd was established in 2002 years. It is a large-scale manufacturer integrating
|