|
|
|
Growth hormone releasing factor fragment 1-40 human
Synonyms: 1-40-human somatoliberin | somatoliberin fragment 1-40, human | human growthhormone-releasing hormone(1-40)-oh | (1-40)-human pancreatic gh-releasing factor | growth hormone releasing factor fragment | human pancreaticgrowth hormone-releasing factor (1-40) | yadaiftnsyrkvlgqlsarkllqdimsrqqgesnqerga | (1-40)-humangrowth hormone-releasing factor | humanpancreatic tumor growth hormone-releasing factor-40 | humangrowth hormone-releasing factor(1-40) | somatoliberin (human pancreatic islet),41-de-l-arginine-42-de-l-alanine-43-de-l-arginine-44-de-l-leucinamide- | 96: pn: us20090175821 seqid: 121 claimed protein | ghrf (1-40), human | human pancreatic growthhormone-releasing factor-40 | tellurium dioxide 99% | grf (1-40) amide (human) | human growth hormone-releasing hormone (1-40) | grf (1-40) (human) | 117: pn: wo0069900 seqid: 121 unclaimedprotein | human pancreatic grf(1-40)-oh | ghrf (1-40), human, amide | (1-40)-human pancreatic growth hormone-releasing factor | hpgrf-40 | growth hormone releasing factor (1-40), human | yadaiftnsyrkvlgqlsarkllqdimsrqqgesnqerga-nh2 | human growth hormone-releasingfactor(1-40)-oh | human pancreatic somatoliberin-40 | 1-40-somatoliberin(human pancreatic islet)
Formula: C194H317 N61 O63 S
Molecular Weight: 159.5988
List of Suppliers
Leap Chem Co., Ltd
Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production. Leap Chem Co., Ltd is supplier for Growth hormone releasing factor fragment 1-40 human.
LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities.
As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. We supply our chemical product Methyl (R)-(Benzhydrylsulfinyl)acetate.
Our client list includes many m ...
Country: P.R.China
Phone: +852-30606658
Telefax:
Safety Information
Storage tempuraturx: -20°C
Most viewed
Within the past time user are also interested in the following chemicals.
Related products:
|
|
|
How do you find
new customers?
click here
Jiangxi Global Natural
Jiangxi Global Natural Spice Co., Ltd. is well known as one of the old enterprises with over 10 yea
Nation Ford Chemical Co
Founded in 1978, Nation Ford Chemical is one of America’s most respected custom and toll manufactur
Suzhou Bichal Biologica
SUZHOU BICHAL BIOLOGICAL TECHNOLOGY CO., LTD is a fast-growing pharmaceutical company that engages
Henan Sinowin Che
Henan Sinowin Chemical Industry Co.,Ltd. is established in 2003, it's located in Zhengzhou industri
Health Biochem Technolo
Health Biochem Technology Co., Ltd. (Hong Kong) was founded in 2015, the group headquarters is loca
Chem. Mallak
MALLAK is a Young bullish Manufacturing company having dreams to catapult India from its current na
|
