www.BuyersGuideChem.com - directory for chemicals and chemical suppliers
Productname:

BGC > Chemicals A-Z > Galanin (porcine)

Galanin (porcine)

Quick view: Suppliers
BGC Id:
171613376250
CAS No.:
Synonyms:
galanin (pig) | gwtlnsagyllgphaidnhrsfhdkygla-nh2 | porcine galanin | gly-trp-thr-leu-asn-ser-ala-gly-tyr-leu-leu-gly-pro-his-ala-lle-asp-asn-his-arg-ser-phe-his-asp-lys-tyr-gly-leu-ala-nh2 | l-alaninamide,glycyl-l-tryptophyl-l-threonyl-l-leucyl-l-asparaginyl-l-seryl-l-alanylglycyl-l-tyrosyl-l-leucyl-l-leucylglycyl-l-prolyl-l-histidyl-l-alanyl-l-isoleucyl-l-a-aspartyl-l-asparaginyl-l-histidyl-l-arginyl-l-seryl-l-phenylalanyl-l-histidyl-l-a-aspartyl-l-lysyl-l-tyrosylglycyl-l-leucyl- | galanin(1-29) porcine | porcine galanin(1-29) | ccris 6750 | galanin, porcine | galanin | pig galanin | galanin(pig) | galanin (swine)
Formula:
C146H213 N43 O40
Molecular Weight:
3210.56

List of Suppliers

Bachem AG

Company type: Leading producer
About Bachem Bachem is a listed technology-based company focused on peptide chemistry. The company provides a full range of services to the pharma and biotech industries. Bachem AG is supplier for Galanin (porcine). It specializes in the development of innovative, efficient manufacturing processes and the reliable production of peptide-based active pharmaceutical ingredients. A comprehensive catalog of biochemicals and exclusive custom syntheses for research labs complete the service portfolio. We sell H-Glu(His-OH)-OH as well. Headquartered in Swi ...
Country: Switzerland   Phone: +41 58 595 2021   Telefax: +41 58 595 2040

Chemos GmbH & Co. KG

Company type: Supplier of chemical products
Chemos is a leading supplier of chemical specialties for your research and production needs. Chemos GmbH & Co. KG is supplier for Galanin (porcine). Everything new starts small and needs specific support during scale up and production. Chemos GmbH & Co. KG also offers 8-Fluoro-4-hydroxyquinoline-3-carboxylic acid. With over 25 years of experience in the fine chemical market Chemos is supporting research institutions and chemical companies in Europe and America. Chemos is a sourcing and distribution company with a grown and strong network of custom manufacturing companies and chemical producers from around the ...
Country: Germany   Phone: +49-871-966346-0   Telefax: +49-871-966346-13

BuGuCh & Partners

Company type: Analytical Institution
We, BuGuCh & Partners, are an international acting and innovative company, leading in developing and manufacturing. We operates major facilities in North America, Europe and the Pacific Rim, as well as facilities in China, Japan and Saudi Arabia operated through joint ventures. We maintain independently or are partners of some production sites in Europe, Asia and South America. BuGuCh & Partners is supplier for Galanin (porcine). We sell 1,1-Cyclohexanediacetimide as well. Our global network is a strength. Our products range from natural gas, oil and basic chemi ...
Country: Germany   Phone:   Telefax:

Leap Chem Co., Ltd

Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production. Leap Chem Co., Ltd also offers 6-[(2-Fluoroanilino)carbonyl]-3-cyclohexene-1-carboxylic acid. LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities. As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. Leap Chem Co., Ltd is supplier for Galanin (porcine). Our client list includes many m ...
Country: P.R.China   Phone: +852-30606658   Telefax:

Safety Information

WGK Germany:
3
Storage tempuraturx:
-20°C

Most viewed

Within the past time user are also interested in the following chemicals.
N-(4-Aminobenzoyl)-beta-alanine
Structure

Hydroxypropylmethylcellulose (HMPC)
Structure

Suppliers and manufactures - with identical CAS number as Galanin (porcine)

For the following products supplier are listed below:
    Porcine galanin(1-29)


Supplier of

Porcine galanin(1-29)

(CAS: 88813-36-9)

Hangzhou Dayangchem Co. Ltd.

Company type: Leading producer
Hangzhou DayangChem Co. Ltd is a comprehensive entity which specializes in development, production and trade of pharmaceutical, agrochemical and dyestuff intermediates as well as some special type reagents. We have an own factory and share enterprises. We supply our chemical product Octahydro-pyrrolo[1,2-a]pyrazine. We act also as agent of many chemical factories and promote their products to the international market at very competitive price. We take "Credi first, Clients supreme" as our aim. We expect to cooperate with more partners ...
Country: P.R.China   Phone: +86-571-88938639   Telefax: +86-571-8893-8652


Related products:


Language:
english português français deutsch español
svensk norsk italiano 中国 日本語 по-русски




How do you find
new customers?

click here


Wuhan Biet Co., Ltd.
WUHAN BIET CO.,LTD was set up in July 2010.It specializes in theproduction,research,development and


BioClot GmbH
BioClot is a leading manufacturer and distributor specialising in quality Animal Blood Serum and re


polypeptide.ltd
Xuchang Shangke Chemical Co., Ltd. (Phcoker / Polypeptide.ltd) was founded in 2008, located in the


ArChemCo
*** This company is not available ***We are the biggest and the most well-known industrial


Jinan Wanxingda Chemica
Jinan Wanxingda chemical Co.,Ltd.was established in 2007 and is located in Jinan City, Shandong Pro


Shandong Shimizu Chemic
Japan-China Joint Venture enterprise, mainly produce Dimethyl Isophthalate and polymerizable esters


© Copyright 1996 to 2024 by Netvertise GmbH. All rights reserved Galanin (porcine)