www.BuyersGuideChem.com - directory for chemicals and chemical suppliers
Productname:

BGC > Chemicals A-Z > GRF (ovine, caprine)

GRF (ovine, caprine)

Quick view: Suppliers
BGC Id:
273095417472
CAS No.:
Synonyms:
ghrf ovine | grf (ovine) | grf (1-44) (ovine) | grf (1-44) (ovine, caprine) | growth hormone releasing factor, ovine | growth hormone releasing factor (1-44) (ovine) | yadaiftnsyrkilgqlsarkllqdimnrqqgernqeqgakvrl-nh2 | growth hormone-releasing factor (1-44) (ovine, caprine) | h-tyr-ala-asp-ala-ile-phe-thr-asn-ser-tyr-arg-lys-ile-leu-gly-gln-leu-ser-ala-arg-lys-leu-leu-gln-asp-ile-met-asn-arg-gln-gln-gly-glu-arg-asn-gln-glu-gln-gly-ala-lys-val-arg-leu-nh2 | somatoliberin(human pancreatic islet), 13-l-isoleucine-28-l-asparagine-34-l-arginine-38-l-glutamine-41-l-lysine-42-l-valine- | l-leucinamide, l-tyrosyl-l-alanyl-l-a-aspartyl-l-alanyl-l-isoleucyl-l-phenylalanyl-l-threonyl-l-asparaginyl-l-seryl-l-tyrosyl-l-arginyl-l-lysyl-l-isoleucyl-l-leucylglycyl-l-glutaminyl-l-leucyl-l-seryl-l-alanyl-l-arginyl-l-lysyl-l-leucyl-l-leucyl-l-glutaminyl-l-a-aspartyl-l-isoleucyl-l-methionyl-l-asparaginyl-l-arginyl-l-glutaminyl-l-glutaminylglycyl-l-a-glutamyl-l-arginyl-l-asparaginyl-l-glutaminyl-l-a-glutamyl-l-glutaminylglycyl-l-alanyl-l-lysyl-l-valyl-l-arginyl- | somatoliberin (sheephypothalamus) (9ci)
Formula:
C221H368 N72 O66 S

List of Suppliers

Bachem AG

Company type: Leading producer
About Bachem Bachem is a listed technology-based company focused on peptide chemistry. Proadrenomedullin (1-20) (human) will be also provided by us. Bachem AG is supplier for GRF (ovine, caprine). The company provides a full range of services to the pharma and biotech industries. It specializes in the development of innovative, efficient manufacturing processes and the reliable production of peptide-based active pharmaceutical ingredients. A comprehensive catalog of biochemicals and exclusive custom syntheses for research labs complete the service portfolio. Headquartered in Swi ...
Country: Switzerland   Phone: +41 58 595 2021   Telefax: +41 58 595 2040

Safety Information

Storage tempuraturx:
-15°C

Most viewed

Within the past time user are also interested in the following chemicals.
Manganese sulfate

Glutaric anhydride
Structure

Suppliers and manufactures - with identical CAS number as GRF (ovine, caprine)

For the following products supplier are listed below:
    GHRF, ovine


The following companies are not suppliers of GRF (ovine, caprine) . This companies are suppliers for equal products with the same CAS number. CAS: 94948-82-0


Supplier of

GHRF, ovine

(CAS: 94948-82-0)

Leap Chem Co., Ltd

Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production. LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities. As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. We sell 4-{[4-(Trifluoromethyl)pyrimidin-2-yl]oxy}benzoic acid as well. Our client list includes many m ...
Country: P.R.China   Phone: +852-30606658   Telefax:


Related products:


Language:
english português français deutsch español
svensk norsk italiano 中国 日本語 по-русски




How do you find
new customers?

click here


Xi´an Function Material
FM established in 2002 and headquartered in XI’AN China, mainly engaged in high pure sputtering tar


Stereokem
Stereokem is a chemistry-savvy, innovation driven company engaged in development, production and ma


Chemlyte Solutions
At Chemlyte Solutions, we place long-term relationships and outstanding client experience at the he


Jiangsu Tetra New Mater
Tetrachem is a high-tech company specialized in R&D, production, sales and technical service of


Autech Industry Co.,Lim
Autech Industry Co., Ltd was established in 2006, the head office is in Jinan City, Shandong Provin


Hangzhou Proserre Chemi
Hangzhou Proserre Chemical Co., LTD established in Dec 2013 is a marketing, contract manufacturing,


© Copyright 1996 to 2024 by Netvertise GmbH. All rights reserved GRF (ovine, caprine)