|
|
GRF (ovine, caprine)
Synonyms: ghrf ovine | grf (ovine) | grf (1-44) (ovine) | grf (1-44) (ovine, caprine) | growth hormone releasing factor, ovine | growth hormone releasing factor (1-44) (ovine) | yadaiftnsyrkilgqlsarkllqdimnrqqgernqeqgakvrl-nh2 | growth hormone-releasing factor (1-44) (ovine, caprine) | h-tyr-ala-asp-ala-ile-phe-thr-asn-ser-tyr-arg-lys-ile-leu-gly-gln-leu-ser-ala-arg-lys-leu-leu-gln-asp-ile-met-asn-arg-gln-gln-gly-glu-arg-asn-gln-glu-gln-gly-ala-lys-val-arg-leu-nh2 | somatoliberin(human pancreatic islet), 13-l-isoleucine-28-l-asparagine-34-l-arginine-38-l-glutamine-41-l-lysine-42-l-valine- | l-leucinamide, l-tyrosyl-l-alanyl-l-a-aspartyl-l-alanyl-l-isoleucyl-l-phenylalanyl-l-threonyl-l-asparaginyl-l-seryl-l-tyrosyl-l-arginyl-l-lysyl-l-isoleucyl-l-leucylglycyl-l-glutaminyl-l-leucyl-l-seryl-l-alanyl-l-arginyl-l-lysyl-l-leucyl-l-leucyl-l-glutaminyl-l-a-aspartyl-l-isoleucyl-l-methionyl-l-asparaginyl-l-arginyl-l-glutaminyl-l-glutaminylglycyl-l-a-glutamyl-l-arginyl-l-asparaginyl-l-glutaminyl-l-a-glutamyl-l-glutaminylglycyl-l-alanyl-l-lysyl-l-valyl-l-arginyl- | somatoliberin (sheephypothalamus) (9ci)
Formula: C221H368 N72 O66 S
List of Suppliers
Bachem AG
Company type: Leading producer
About Bachem
Bachem is a listed technology-based company focused on peptide chemistry. Proadrenomedullin (1-20) (human) will be also provided by us. Bachem AG is supplier for GRF (ovine, caprine). The company provides a full range of services to the pharma and biotech industries. It specializes in the development of innovative, efficient manufacturing processes and the reliable production of peptide-based active pharmaceutical ingredients. A comprehensive catalog of biochemicals and exclusive custom syntheses for research labs complete the service portfolio. Headquartered in Swi ...
Country: Switzerland
Phone: +41 58 595 2021
Telefax: +41 58 595 2040
Safety Information
Storage tempuraturx: -15°C
Most viewed
Within the past time user are also interested in the following chemicals.
Suppliers and manufactures - with identical CAS number as GRF (ovine, caprine)
For the following products supplier are listed below:
GHRF, ovine
The following companies are not suppliers of GRF (ovine, caprine) . This companies are suppliers for equal products with the same CAS number. CAS: 94948-82-0
Leap Chem Co., Ltd
Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production.
LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities.
As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. We sell 4-{[4-(Trifluoromethyl)pyrimidin-2-yl]oxy}benzoic acid as well.
Our client list includes many m ...
Country: P.R.China
Phone: +852-30606658
Telefax:
Related products:
GRF (ovine, caprine); Somatocrinin (ovine, caprine), Somatoliberin (ovine, caprine), GHRH (ovine, caprine), Growth Hormone-Releasing Hormone (ovine, caprine), Growth Hormone-Releasing Factor (ovine, c
|
|
|
How do you find new customers?
click here
Xi´an Function Material
FM established in 2002 and headquartered in XIAN China, mainly engaged in high pure sputtering tar
Stereokem
Stereokem is a chemistry-savvy, innovation driven company engaged in development, production and ma
Chemlyte Solutions
At Chemlyte Solutions, we place long-term relationships and outstanding client experience at the he
Jiangsu Tetra New Mater
Tetrachem is a high-tech company specialized in R&D, production, sales and technical service of
Autech Industry Co.,Lim
Autech Industry Co., Ltd was established in 2006, the head office is in Jinan City, Shandong Provin
Hangzhou Proserre Chemi
Hangzhou Proserre Chemical Co., LTD established in Dec 2013 is a marketing, contract manufacturing,
|