www.BuyersGuideChem.com - directory for chemicals and chemical suppliers
Productname:

BGC > Chemicals A-Z > Exendin-4 (3-39)

Exendin-4 (3-39)

Quick view: Suppliers
BGC Id:
811647789349
CAS No.:
Synonyms:
egtftsdlskqmeeeavrlfiewlknggpssgappps-nh2 | 3-39-exendin 4(heloderma suspectum) (9ci) | exendin-4 (3-39) | exendin (3-39) | h-glu-gly-thr-phe-thr-ser-asp-leu-ser-lys-gln-met-glu-glu-glu-ala-val-arg-leu-phe-ile-glu-trp-leu-lys-asn-gly-gly-pro-ser-ser-gly-ala-pro-pro-pro-ser-nh2 | m.w. 3992.42 c176h272n46o58s
Formula:
C176H272 N46 O58 S

List of Suppliers

Bachem AG

Company type: Leading producer
About Bachem Bachem is a listed technology-based company focused on peptide chemistry. Bachem AG is supplier for Exendin-4 (3-39). Boc-D-His-OH is also served by Bachem AG. The company provides a full range of services to the pharma and biotech industries. It specializes in the development of innovative, efficient manufacturing processes and the reliable production of peptide-based active pharmaceutical ingredients. A comprehensive catalog of biochemicals and exclusive custom syntheses for research labs complete the service portfolio. Headquartered in Swi ...
Country: Switzerland   Phone: +41 58 595 2021   Telefax: +41 58 595 2040

BuGuCh & Partners

Company type: Analytical Institution
We, BuGuCh & Partners, are an international acting and innovative company, leading in developing and manufacturing. We operates major facilities in North America, Europe and the Pacific Rim, as well as facilities in China, Japan and Saudi Arabia operated through joint ventures. We maintain independently or are partners of some production sites in Europe, Asia and South America. BuGuCh & Partners is supplier for Exendin-4 (3-39). BuGuCh & Partners is a seller of 6-Amino-2,2-dimethyl-2H-pyrido[3,2-b] [1,4]oxazin-3[4H]-one. Our global network is a strength. Our products range from natural gas, oil and basic chemi ...
Country: Germany   Phone:   Telefax:

Leap Chem Co., Ltd

Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production. Leap Chem Co., Ltd is supplier for Exendin-4 (3-39). LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities. We are supplier of Chrysene,2-diol-3,4-epoxide-1. As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. Our client list includes many m ...
Country: P.R.China   Phone: +852-30606658   Telefax:

Safety Information

Storage tempuraturx:
-15°C

Most viewed

Within the past time user are also interested in the following chemicals.


Related products:


Language:
english português français deutsch español
svensk norsk italiano 中国 日本語 по-русски




How do you find
new customers?

click here


Nantong Baihua Bio-phar
We are a global supplier for pharmaceutical intermediates, fine chemicals, building blocks, rare co


Jiangsu Tetra New Mater
Tetrachem is a high-tech company specialized in R&D, production, sales and technical service of


Stereokem
Stereokem is a chemistry-savvy, innovation driven company engaged in development, production and ma


Anhard Export
The Anhard Export way... The Textile industry is in a constant state of flux. Changing seasons, cha


Prakash Chemicals Inter
Prakash Chemicals International Pvt. Ltd. (PCIPL) today, stands as an archetype of unmatched qualit


ArChemCo
*** This company is not available ***We are the biggest and the most well-known industrial


© Copyright 1996 to 2024 by Netvertise GmbH. All rights reserved Exendin-4 (3-39)