|
|
|
CART (55-102) (human)
Synonyms: cart peptide (aa 55-102), human | cocaine-and amphetamine-regulated transcript (55-102) (human) | h-val-pro-ile-tyr-glu-lys-lys-tyr-gly-gln-val-pro-met-cys-asp-ala-gly-glu-gln-cya-ala-val-arg-lys-gly-ala-arg-ile-gly-lys-leu-cys-asp-pro-arg-gly-thr-ser-cys-asn-ser-pheleu-leu-lys-cys-leu-oh | cocaine- and amphetamine-regulated transcript (human, 55-102) | 42-89-protein cart (human) | cart (human, 55-102) | h-val-pro-ile-tyr-glu-lys-lys-tyr-gly-gln-val-pro-met-cys-asp-ala-gly-glu-gln-cys-ala-val-arg-lys-gly-ala-arg-ile-gly-lys-leu-cys-asp-cys-pro-arg-gly-thr-ser-cys-asn-ser-phe-leu-leu-lys-cys-leu-oh | h-val-pro-ile-tyr-glu-lys-lys-tyr-gly-gln-val-pro-met-cys-asp-ala-gly-glu-gln-cys-ala-val-arg-lys-gly-ala-arg-ile-gly-lys-leu-cys-asp-cys-pro-arg-gly-thr-ser-cys-asn-ser-phe-leu-leu-lys-cys-leu-oh (disulfide bridge: 74-94, 68-86, and 88-101) | cart (55-102) (human) | cocaine- and amphetamine-regulated transcript 55-102 | cocaine- and amphetamine-regulated transcript (human, 55-102) | vpiyekkygqvpmcdageqcavrkgarigklcdcprgtscnsfllkcl (disulfide bridge: 74-94,68-86 and 88-101) | cart (55-102)
List of Suppliers
Bachem AG
Company type: Leading producer
About Bachem
Bachem is a listed technology-based company focused on peptide chemistry. The company provides a full range of services to the pharma and biotech industries. Bachem AG is supplier for CART (55-102) (human). It specializes in the development of innovative, efficient manufacturing processes and the reliable production of peptide-based active pharmaceutical ingredients. Additionally H-beta-Ala-OH is supplied by us. A comprehensive catalog of biochemicals and exclusive custom syntheses for research labs complete the service portfolio. Headquartered in Swi ...
Country: Switzerland
Phone: +41 58 595 2021
Telefax: +41 58 595 2040
BuGuCh & Partners
Company type: Analytical Institution
We, BuGuCh & Partners, are an international acting and innovative company, leading in developing and manufacturing.
We operates major facilities in North America, Europe and the Pacific Rim, as well as facilities in China, Japan and Saudi Arabia operated through joint ventures.
We maintain independently or are partners of some production sites in Europe, Asia and South America. We supply our chemical product . BuGuCh & Partners is supplier for CART (55-102) (human). Our global network is a strength.
Our products range from natural gas, oil and basic chemi ...
Country: Germany
Phone:
Telefax:
Leap Chem Co., Ltd
Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production.
LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities. We provide Ethyl 4-chloro-7-(phenylsulfonyl)-7H-pyrrolo[2,3-d]pyrimidine-6-carboxylate as well.
As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. Leap Chem Co., Ltd is supplier for CART (55-102) (human).
Our client list includes many m ...
Country: P.R.China
Phone: +852-30606658
Telefax:
Safety Information
Storage tempuraturx: -15°C
Related products:
|
|
|
How do you find
new customers?
click here
Nanjing Fred Technology
Nanjing Fred technology Co., Ltd. is a high-tech enterprise engaged in the R&D, production and
Vistachem Europe GmbH
As reliable providers of chemicals from across the globe, our world-wide web sources and supplies t
Qingdao QY Liquid Cryst
15 years of PDLC liquid crystal production experience. Qingdao QY Liquid Crystal Co., Ltd. is a pr
Hangzhou Reward Technol
Hangzhou Longman New Material Co., Ltd. (Hangzhou Reward Technology Co., Ltd.) is located in the fa
ECSA Chemicals AG
Established in 1913 ECSA Chemicals has become one of the most important Swiss-owned distributors of
BuGuCh & Partners
We, BuGuCh & Partners, are an international acting and innovative company, leading in developin
|
