|
|
|
Neuropeptide Y (3-36) (human, rat)
Synonyms: 3-36-neuropeptide y (human) | neuropeptide y fragment 3-36 human, rat,neuropeptide y fr | 3-36-neuropeptide y(human) | neuropeptide y fragment 3-36 human, rat | npy (3-36), human | npy 3-36 | neuropeptide y (3-36) human | skpdnpgedapaedmaryysalrhyinlitrqry-nh2 | neuropeptide y (3-36) (human, rat) | npy (3-36) (human, rat) | neuropeptidey (pig), 1-de-l-tyrosine-2-de-l-proline-17-l-methionine- | human neuropeptidey(3-36) | human neuropeptide y(3-36)
Formula: C175H269 N53 O54 S
List of Suppliers
Bachem AG
Company type: Leading producer
About Bachem
Bachem is a listed technology-based company focused on peptide chemistry. The company provides a full range of services to the pharma and biotech industries. (Des-Gly10,D-His2,D-Trp6,Pro-NHEt9)-LHRH is also served by Bachem AG. It specializes in the development of innovative, efficient manufacturing processes and the reliable production of peptide-based active pharmaceutical ingredients. Bachem AG is supplier for Neuropeptide Y (3-36) (human, rat). A comprehensive catalog of biochemicals and exclusive custom syntheses for research labs complete the service portfolio. Headquartered in Swi ...
Country: Switzerland
Phone: +41 58 595 2021
Telefax: +41 58 595 2040
BuGuCh & Partners
Company type: Analytical Institution
We, BuGuCh & Partners, are an international acting and innovative company, leading in developing and manufacturing.
We operates major facilities in North America, Europe and the Pacific Rim, as well as facilities in China, Japan and Saudi Arabia operated through joint ventures.
We maintain independently or are partners of some production sites in Europe, Asia and South America. BuGuCh & Partners is supplier for Neuropeptide Y (3-36) (human, rat). BuGuCh & Partners is a seller of 1-Methyl-1H-imidazole-4-carbonitrile. Our global network is a strength.
Our products range from natural gas, oil and basic chemi ...
Country: Germany
Phone:
Telefax:
Safety Information
Storage tempuraturx: -20°C
Most viewed
Within the past time user are also interested in the following chemicals.
Suppliers and manufactures - with identical CAS number as Neuropeptide Y (3-36) (human, rat)
For the following products supplier are listed below:
H-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2
Leap Chem Co., Ltd
Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production.
LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities.
As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. We are supplier of 1-(Phenylsulfonyl)-4-bromo-7-azaindole-2-carboxylic acid.
Our client list includes many m ...
Country: P.R.China
Phone: +852-30606658
Telefax:
Related products:
|
|
|
How do you find
new customers?
click here
Meryer (Shanghai) Chemi
Our products cover organic, inorganic, analytical and biochemical reagents including pharmaceutical
Wuhan Monad Medicine Te
Wuhan Monad Medicine Tech Co.,LTD was established in 2016.，is a high-tech innovative enterprise spe
H&Z Industry Co.,Ltd
H&Z Industry Co.,Ltd is a large reliable and professional manufacturer of chemical materials a
Jiangsu Kolod Food Ingr
Jiangsu Kolod Food Ingredients Co., Ltd. is a professional manufacturer of phosphates, citrates, ch
United New Materials Te
UMT focuse to research and produce high purity chemical and materials for application of food, phar
Vistachem Europe GmbH
As reliable providers of chemicals from across the globe, our world-wide web sources and supplies t
|
