|
|
|
Beta-Amyloid (40-1)
Synonyms: amyloid beta-protein (40-1) trifluoroacetate | human b-amyloid peptide-(40-1) | amyloid b-protein (40-1) | amyloid beta-protein (40-1) | amyloid β-protein (40-1) | 280:pn: wo0069900 seqid: 960 unclaimed protein | amyloid β-protein fragment 40-1 | vvggvmlgiiagknsgvdeaffvlkqhhveygsdhrfead | l-aspartic acid,l-valyl-l-valylglycylglycyl-l-valyl-l-methionyl-l-leucylglycyl-l-isoleucyl-l-isoleucyl-l-alanylglycyl-l-lysyl-l-asparaginyl-l-serylglycyl-l-valyl-l-a-aspartyl-l-a-glutamyl-l-alanyl-l-phenylalanyl-l-phenylalanyl-l-valyl-l-leucyl-l-lysyl-l-glutaminyl-l-histidyl-l-histidyl-l-valyl-l-a-glutamyl-l-tyrosylglycyl-l-seryl-l-a-aspartyl-l-histidyl-l-arginyl-l-phenylalanyl-l-a-glutamyl-l-alanyl- | 766: pn: us20090175821 seqid: 960claimed protein | amyloid b-protein, fragment 40-1 | beta-amyloid (40-1) | amyloid beta-protein fragment 40-1 | amyloid b-protein
Formula: C194H295 N53 O58 S
List of Suppliers
Alpha Biopharmaceuticals Co., Ltd.
Company type: Producer
Alabiochem company locates at a beautiful chinese city-SuZhou. We are a professional biochemical company engaged in researching, developing, manufacturing pharmaceutical peptide、new amino acid, peptide synthetic technique and new type of peptide. Moreover, we are focused on nucleic acid and other small organic compounds. Alabiochem company not only provides contact research but custom synthesis service. Alpha Biopharmaceuticals Co., Ltd. is supplier for Beta-Amyloid (40-1). We sell 88321-09-9 as well.
Country: P.R.China
Phone: +86-411-39042497
Telefax: +86-411-39042693
Safety Information
Storage tempuraturx: -20°C
Most viewed
Within the past time user are also interested in the following chemicals.
Suppliers and manufactures - with identical CAS number as Beta-Amyloid (40-1)
For the following products supplier are listed below:
Amyloid beta-Protein (40-1)
Amyloid b-Protein (40-1)
The following companies are not suppliers of Beta-Amyloid (40-1) . This companies are suppliers for equal products with the same CAS number. CAS: 144409-99-4
BuGuCh & Partners
Company type: Analytical Institution
We, BuGuCh & Partners, are an international acting and innovative company, leading in developing and manufacturing.
We operates major facilities in North America, Europe and the Pacific Rim, as well as facilities in China, Japan and Saudi Arabia operated through joint ventures.
We maintain independently or are partners of some production sites in Europe, Asia and South America. We supply our chemical product 4-[2-(Dimethylamino)ethyl]-phenol. Our global network is a strength.
Our products range from natural gas, oil and basic chemi ...
Country: Germany
Phone:
Telefax:
Leap Chem Co., Ltd
Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production. We provide Propiophenone, 3-(cyclopropylamino)-3,4-dimethyl- as well.
LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities.
As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner.
Our client list includes many m ...
Country: P.R.China
Phone: +852-30606658
Telefax:
Bachem AG
Company type: Leading producer
About Bachem
Bachem is a listed technology-based company focused on peptide chemistry. The company provides a full range of services to the pharma and biotech industries. We are supplier of Z-Leu-Arg-4MbetaNA. It specializes in the development of innovative, efficient manufacturing processes and the reliable production of peptide-based active pharmaceutical ingredients. A comprehensive catalog of biochemicals and exclusive custom syntheses for research labs complete the service portfolio. Headquartered in Swi ...
Country: Switzerland
Phone: +41 58 595 2021
Telefax: +41 58 595 2040
Related products:
|
|
|
How do you find
new customers?
click here
Qingdao QY Liquid Cryst
15 years of PDLC liquid crystal production experience. Qingdao QY Liquid Crystal Co., Ltd. is a pr
Vistachem Europe GmbH
As reliable providers of chemicals from across the globe, our world-wide web sources and supplies t
Nanjing Shunxiang Pharm
Shunxiang is a comprehensive company specializing in the development, production and marketing of n
Meryer (Shanghai) Chemi
Our products cover organic, inorganic, analytical and biochemical reagents including pharmaceutical
Wuhan Alpha & Omega Pha
This is Wuhan Alpha & Omega Pharmaceuticals LTD. We are located in Hubei province of China. We
Zley Holdings (SuZhou)
The R&D group of ZLEY （WEINAN CHANGTONG PHARMACHEM TECH CO., LTD.）has spent 33 years cultivatin
|
