|
|
|
BNP-32 (rat)
Synonyms: b-type (brain) natriuretic peptide-32 (rat) | 14-45-brain natriuretic peptide-45 (rat) | natriuretic factor-32, rat brain | 1,2-dithia-5,8,11,14,17,20,23,26,29,32,35,38,41,44,47,50-hexadecaazacyclotripentacontane,cyclic peptide deriv. | bnp (1-32) rat | bnp (51-95), rat | nskmahssscfgqkidrigavsrlgcdglrlf | brain natriuretic peptide-32 (rat) | 14-45-brain natriureticpeptide-45 (rat) (9ci) | rat brain natriuretic peptide(1-32) | bnp-32 (rat) | natriureticfactor-45 (rat brain), 1-de-l-serine-2-de-l-glutamine-3-de-l-asparticacid-4-de-l-serine-5-de-l-alanine-6-de-l-phenylalanine-7-de-l-arginine-8-de-l-isoleucine-9-de-l-glutamine-10-de-l-glutamicacid-11-de-l-arginine-12-de-l-leucine-13-de-l-arginine- | brain natriuretic peptide (1-32), rat | rat brain natriureticpeptide(1-32) | bnp rat | rat brain natriuretic peptide-32
Formula: C146H239 N47 O44 S3
List of Suppliers
Bachem AG
Company type: Leading producer
About Bachem
Bachem is a listed technology-based company focused on peptide chemistry. Bachem AG is supplier for BNP-32 (rat). Bachem AG also offers Biotinyl-(Lys153·159,Leu161)-Histone H1 (149-161) (salmon). The company provides a full range of services to the pharma and biotech industries. It specializes in the development of innovative, efficient manufacturing processes and the reliable production of peptide-based active pharmaceutical ingredients. A comprehensive catalog of biochemicals and exclusive custom syntheses for research labs complete the service portfolio. Headquartered in Swi ...
Country: Switzerland
Phone: +41 58 595 2021
Telefax: +41 58 595 2040
Skyrun Industrial Co., Ltd.
Company type: Leading producer
Skyrun Industrial Co.Limited, established in 2003, a state-controlled company (By Skyrun Corp. & High Hope) in China, specializing in developing, producing and handing raw pharmaceutical material and intermediates. Skyrun Industrial Co., Ltd. is supplier for BNP-32 (rat). Fmoc-L-Hydroxyproline will be also provided by us. We have expanded a compositive entity from initially only as a small manufacturer. We have extensive knowledge of domestic and international pharmaceutical markets. Our working range can be start from small amount in research stage to big bulk for industrial produc ...
Country: P.R.China
Phone: +86-576-84015261
Telefax: +86-576-84015261
Leap Chem Co., Ltd
Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production.
LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities.
As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. Leap Chem Co., Ltd is supplier for BNP-32 (rat). We supply our chemical product 5-Thiazolol.
Our client list includes many m ...
Country: P.R.China
Phone: +852-30606658
Telefax:
Safety Information
Storage tempuraturx: -20°C
Most viewed
Within the past time user are also interested in the following chemicals.
Suppliers and manufactures - with identical CAS number as BNP-32 (rat)
For the following products supplier are listed below:
Rat brain natriuretic peptide(1-32)
The following companies are not suppliers of BNP-32 (rat) . This companies are suppliers for equal products with the same CAS number. CAS: 133448-20-1
Alpha Biopharmaceuticals Co., Ltd.
Company type: Producer
Alabiochem company locates at a beautiful chinese city-SuZhou. We are a professional biochemical company engaged in researching, developing, manufacturing pharmaceutical peptide、new amino acid, peptide synthetic technique and new type of peptide. FMoc-N-Me-His(Trt)-OH is also served by Alpha Biopharmaceuticals Co., Ltd.. Moreover, we are focused on nucleic acid and other small organic compounds. Alabiochem company not only provides contact research but custom synthesis service.
Country: P.R.China
Phone: +86-411-39042497
Telefax: +86-411-39042693
|
|
|
How do you find
new customers?
click here
Alpha Biopharmaceutical
Alabiochem company locates at a beautiful chinese city-SuZhou. We are a professional biochemical co
Nation Ford Chemical Co
Founded in 1978, Nation Ford Chemical is one of America’s most respected custom and toll manufactur
Codexis, Inc.
Is a world leader in providing unique, state-of-the-art enzyme optimization services and developing
JieJie Group Co., Ltd.
Shanghai JieJie Chemical Co., Ltd is a pharmaceutical and chemical enterprise for the research and
Hangzhou Cherry Pharmac
Hangzhou Cherry Pharmaceutical Technology Co., LTD is a marketing company from China engaged in pha
Jinan Honestpharm Co.,
Jinan Honestpharm Co., Ltd is a leading global supplier of advanced intermediates and laboratory ch
|
