|
|
|
Pancreatic polypeptide, human
Synonyms: pp, human | ala-pro-leu-glu-pro-val-tyr-pro-gly-asp-asn-ala-thr-pro-glu-gln-met-ala-gln-tyr-ala-ala-asp-leu-arg-arg-tyr-ile-asn-met-leu-thr-arg-pro-arg-tyr-nh2 human | aplepvypgdnatpeqmaqyaadlrryinmltrpry-nh2 | ala-pro-leu-glu-pro-val-tyr-pro-gly-asp-asn-ala-thr-pro-glu-gln-met-ala-gln-met-ala-gln-tyr-ala-ala-asp-leu-arg-arg-tyr-ile-asn-met-leu-thr-arg-pro-arg-tyr-nh2 | pancreatichormone iii | pancreatic polypeptide, human synthetic >99% | fbavian ::fn | ala-pro-leu-glu-pro-val-tyr-pro-gly-asp-asn-ala-thr-pro-glu-gln-met-ala-gln-tyr-ala-ala-asp-leu-arg-arg-tyr-ile-asn-met-leu-thr-arg-pro-arg-tyr-nh2 | h-ala-pro-leu-glu-pro-val-tyr-pro-gly-asp-asn-ala-thr-pro-glu-gln-met-ala-gln-tyr-ala-ala-asp-leu-arg-arg-tyr-ile-asn-met-leu-thr-arg-pro-arg-tyr-nh2 | pancreatic polypeptide, human | pancreatic polypeptide
Molecular Weight: 444.5205
List of Suppliers
Leap Chem Co., Ltd
Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production. Leap Chem Co., Ltd is a seller of 5-Chloro-2,4-difluoro-benzoic acid methyl ester.
LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities.
As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. Leap Chem Co., Ltd is supplier for Pancreatic polypeptide, human.
Our client list includes many m ...
Country: P.R.China
Phone: +852-30606658
Telefax:
Specification
Boiling Point: 612.8 °C at 760 mmHg
Safety Information
Storage tempuraturx: -20 °C
Most viewed
Within the past time user are also interested in the following chemicals.
Tributoxy ethyl phosphate
Suppliers and manufactures - with identical CAS number as Pancreatic polypeptide, human
For the following products supplier are listed below:
Pancreatic polypeptide (human)
The following companies are not suppliers of Pancreatic polypeptide, human . This companies are suppliers for equal products with the same CAS number. CAS: 59763-91-6
BuGuCh & Partners
Company type: Analytical Institution
We, BuGuCh & Partners, are an international acting and innovative company, leading in developing and manufacturing.
We operates major facilities in North America, Europe and the Pacific Rim, as well as facilities in China, Japan and Saudi Arabia operated through joint ventures.
We maintain independently or are partners of some production sites in Europe, Asia and South America. We provide 3,5-Dichlorophenethyl alcohol as well. Our global network is a strength.
Our products range from natural gas, oil and basic chemi ...
Country: Germany
Phone:
Telefax:
|
|
|
How do you find
new customers?
click here
Hangzhou Proserre Chemi
Hangzhou Proserre Chemical Co., LTD established in Dec 2013 is a marketing, contract manufacturing,
Vistachem Europe GmbH
As reliable providers of chemicals from across the globe, our world-wide web sources and supplies t
Anhard Export
The Anhard Export way... The Textile industry is in a constant state of flux. Changing seasons, cha
Anhui Chufeng Medical T
Chufeng was established in 2020, located in Innovation Industrial Park in Hefei High-tech district,
New Natural Biotechnolo
New Natural is a Developer, Manufacturer, Exporter and Supplier of herbal extracts. We specialize i
Wuhan Alpha & Omega Pha
This is Wuhan Alpha & Omega Pharmaceuticals LTD. We are located in Hubei province of China. We
|
