|
|
|
GHRF, ovine
Synonyms: ghrf ovine | grf (ovine) | grf (1-44) (ovine) | grf (1-44) (ovine, caprine) | growth hormone releasing factor, ovine | growth hormone releasing factor (1-44) (ovine) | yadaiftnsyrkilgqlsarkllqdimnrqqgernqeqgakvrl-nh2 | growth hormone-releasing factor (1-44) (ovine, caprine) | h-tyr-ala-asp-ala-ile-phe-thr-asn-ser-tyr-arg-lys-ile-leu-gly-gln-leu-ser-ala-arg-lys-leu-leu-gln-asp-ile-met-asn-arg-gln-gln-gly-glu-arg-asn-gln-glu-gln-gly-ala-lys-val-arg-leu-nh2 | somatoliberin(human pancreatic islet), 13-l-isoleucine-28-l-asparagine-34-l-arginine-38-l-glutamine-41-l-lysine-42-l-valine- | l-leucinamide, l-tyrosyl-l-alanyl-l-a-aspartyl-l-alanyl-l-isoleucyl-l-phenylalanyl-l-threonyl-l-asparaginyl-l-seryl-l-tyrosyl-l-arginyl-l-lysyl-l-isoleucyl-l-leucylglycyl-l-glutaminyl-l-leucyl-l-seryl-l-alanyl-l-arginyl-l-lysyl-l-leucyl-l-leucyl-l-glutaminyl-l-a-aspartyl-l-isoleucyl-l-methionyl-l-asparaginyl-l-arginyl-l-glutaminyl-l-glutaminylglycyl-l-a-glutamyl-l-arginyl-l-asparaginyl-l-glutaminyl-l-a-glutamyl-l-glutaminylglycyl-l-alanyl-l-lysyl-l-valyl-l-arginyl- | somatoliberin (sheephypothalamus) (9ci)
Formula: C221H368 N72 O66 S
List of Suppliers
Leap Chem Co., Ltd
Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production. We sell 4-{[4-(Trifluoromethyl)pyrimidin-2-yl]oxy}benzoic acid as well.
LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities.
As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. Leap Chem Co., Ltd is supplier for GHRF, ovine.
Our client list includes many m ...
Country: P.R.China
Phone: +852-30606658
Telefax:
Safety Information
Storage tempuraturx: -15°C
Most viewed
Within the past time user are also interested in the following chemicals.
Suppliers and manufactures - with identical CAS number as GHRF, ovine
For the following products supplier are listed below:
GRF (ovine, caprine)
Bachem AG
Company type: Leading producer
About Bachem
Bachem is a listed technology-based company focused on peptide chemistry. The company provides a full range of services to the pharma and biotech industries. Bachem AG also offers Proadrenomedullin (1-20) (human). It specializes in the development of innovative, efficient manufacturing processes and the reliable production of peptide-based active pharmaceutical ingredients. A comprehensive catalog of biochemicals and exclusive custom syntheses for research labs complete the service portfolio. Headquartered in Swi ...
Country: Switzerland
Phone: +41 58 595 2021
Telefax: +41 58 595 2040
|
|
|
How do you find
new customers?
click here
Shanghai Juyuan Flame R
Shanghai Juyuan Flame-Retardant Material Co., Ltd is an enterprise professionally producing and man
Suzhou Bichal Biologica
SUZHOU BICHAL BIOLOGICAL TECHNOLOGY CO., LTD is a fast-growing pharmaceutical company that engages
Corvay Specialty Chemic
Corvay Specialty Chemicals GmbH distributes high quality specialty chemicals from selected manufact
Anhard Export
The Anhard Export way... The Textile industry is in a constant state of flux. Changing seasons, cha
Alpha Biopharmaceutical
Alabiochem company locates at a beautiful chinese city-SuZhou. We are a professional biochemical co
Chemport Science & Tech
Chemport is a R&D oriented company, providing innovative synthesis solutions to the customers i
|
