www.BuyersGuideChem.com - directory for chemicals and chemical suppliers
Productname:

BGC > Chemicals A-Z > Amyloid beta-Protein (1-38)

Amyloid beta-Protein (1-38)

Quick view: Suppliers
BGC Id:
451642940698
CAS No.:
Synonyms:
amyloid beta-protein (1-38) | daefrhdsgyevhhqklvffaedvgsnkgaiiglmvgg | amyloid beta-protein fragment 1-38 | h-asp-ala-glu-phe-arg-his-asp-ser-gly-tyr-glu-val-his-his-gln-lys-leu-val-phe-phe-ala-glu-asp-val-gly-ser-asn-lys-gly-ala-ile-ile-gly-leu-met-val-gly-gly-oh | beta-amyloid (1-38) | amyloid b-protein (1-38) | amyloid b-protein fragment 1-38 | amyloid β protein fragment 1-38
Formula:
C184H277N51O56S1
Molecular Weight:
4131.54

List of Suppliers

Leap Chem Co., Ltd

Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production. Leap Chem Co., Ltd is supplier for Amyloid beta-Protein (1-38). We are seller of 7-(2-Oxopropoxy)-2,3-dihydro-1H-cyclopenta[c]chromen-4-one. LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities. As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. Our client list includes many m ...
Country: P.R.China   Phone: +852-30606658   Telefax:

Specification

Solubility:
H2O: 1 mg/mL

Safety Information

WGK Germany:
3
Storage tempuraturx:
-20°C

Most viewed

Within the past time user are also interested in the following chemicals.
s
Calcium folinate
Structure

Suppliers and manufactures - with identical CAS number as Amyloid beta-Protein (1-38)

For the following products supplier are listed below:
    Amyloid b-Protein (1-38)

Supplier of

Amyloid b-Protein (1-38)

 (CAS: 131438-74-9)

Bachem AG

Company type: Leading producer
About Bachem Bachem is a listed technology-based company focused on peptide chemistry. The company provides a full range of services to the pharma and biotech industries. It specializes in the development of innovative, efficient manufacturing processes and the reliable production of peptide-based active pharmaceutical ingredients. Tyrosinase (243-251) (human) will be also provided by us. A comprehensive catalog of biochemicals and exclusive custom syntheses for research labs complete the service portfolio. Headquartered in Swi ...
Country: Switzerland   Phone: +41 58 595 2021   Telefax: +41 58 595 2040


Related products:


Language:
english português français deutsch español
svensk norsk italiano 中国 日本語 по-русски




How do you find
new customers?
click here


Prakash Chemicals Inter
Prakash Chemicals International Pvt. Ltd. (PCIPL) today, stands as an archetype of unmatched qualit


Jinan Wanxingda Chemica
Jinan Wanxingda chemical Co.,Ltd.was established in 2007 and is located in Jinan City, Shandong Pro


Anhui Cheer-Our Medical
ANHUI CHEER-OUR MEDICAL TECHNOLOGY CO.,LTD is one company mainly manufacturing, developing and supp


Nantong Baihua Bio-phar
We are a global supplier for pharmaceutical intermediates, fine chemicals, building blocks, rare co


Zhengzhou Key-chemi Bio
Zhengzhou Key-chemi biotechnology co., LTD. is a high-tech company committed to the field of chemic


Corvay Specialty Chemic
Corvay Specialty Chemicals GmbH distributes high quality specialty chemicals from selected manufact


© Copyright 1996 to 2024 by Netvertise GmbH. All rights reserved Amyloid beta-Protein (1-38)