www.BuyersGuideChem.com - directory for chemicals and chemical suppliers
Productname:

BGC > Chemicals A-Z > Amylin (8-37) (rat)

Amylin (8-37) (rat)

Structure
Quick view: Suppliers
BGC Id:
241646539572
CAS No.:
Synonyms:
atqrlanflvrssnnlgpvlpptnvgsnty-nh2 | l-tyrosinamide,l-alanyl-l-threonyl-l-glutaminyl-l-arginyl-l-leucyl-l-alanyl-l-asparaginyl-l-phenylalanyl-l-leucyl-l-valyl-l-arginyl-l-seryl-l-seryl-l-asparaginyl-l-asparaginyl-l-leucylglycyl-l-prolyl-l-valyl-l-leucyl-l-prolyl-l-prolyl-l-threonyl-l-asparaginyl-l-valylglycyl-l-seryl-l-asparaginyl-l-threonyl-(9ci) | amylin (8-37) (rat) | h-ala-thr-gln-arg-leu-ala-asn-phe-leu-val-arg-ser-ser-asn-asn-leu-gly-pro-val-leu-pro-pro-thr-asn-val-gly-ser-asn-thr-tyr-nh2 | amylin(837)(rat) | diabetes associated peptide amide*fragment 8-37 r | ala-thr-gln-arg-leu-ala-asn-phe-leu-val-arg-ser-ser-asn-asn-leu-gly-pro-val-leu-pro-pro-thr-asn-val-gly-ser-asn-thr-tyr-nh2 | amylin (8-37) (mouse, rat) | halathrglnargleualaasnpheleuvalargserserasnasnleuglyprovalleuproprothrasnvalglyserasnthrtyrnh2
Formula:
C140H227 N43 O43
Molecular Weight:
3200.56

List of Suppliers

BuGuCh & Partners

Company type: Analytical Institution
We, BuGuCh & Partners, are an international acting and innovative company, leading in developing and manufacturing. We operates major facilities in North America, Europe and the Pacific Rim, as well as facilities in China, Japan and Saudi Arabia operated through joint ventures. We maintain independently or are partners of some production sites in Europe, Asia and South America. BuGuCh & Partners is supplier for Amylin (8-37) (rat). Additionally N-Desmethylterbinafine is supplied by us. Our global network is a strength. Our products range from natural gas, oil and basic chemi ...
Country: Germany   Phone:   Telefax:

Leap Chem Co., Ltd

Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production. Leap Chem Co., Ltd is a seller of (+)-2-Carene. LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities. As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. Leap Chem Co., Ltd is supplier for Amylin (8-37) (rat). Our client list includes many m ...
Country: P.R.China   Phone: +852-30606658   Telefax:

Safety Information

Storage tempuraturx:
-15°C

Most viewed

Within the past time user are also interested in the following chemicals.
Castor oil

Methyl-6-O-(triphenylmethyl)-trityl-D-mannopyranoside
Structure

Suppliers and manufactures - with identical CAS number as Amylin (8-37) (rat)

For the following products supplier are listed below:
    Amylin (8-37) (mouse, rat)


Supplier of

Amylin (8-37) (mouse, rat)

(CAS: 138398-61-5)

Hangzhou Dayangchem Co. Ltd.

Company type: Leading producer
Hangzhou DayangChem Co. Ltd is a comprehensive entity which specializes in development, production and trade of pharmaceutical, agrochemical and dyestuff intermediates as well as some special type reagents. We have an own factory and share enterprises. Barium phthalate is also served by Hangzhou Dayangchem Co. Ltd.. We act also as agent of many chemical factories and promote their products to the international market at very competitive price. We take "Credi first, Clients supreme" as our aim. We expect to cooperate with more partners ...
Country: P.R.China   Phone: +86-571-88938639   Telefax: +86-571-8893-8652

Bachem AG

Company type: Leading producer
About Bachem Bachem is a listed technology-based company focused on peptide chemistry. The company provides a full range of services to the pharma and biotech industries. It specializes in the development of innovative, efficient manufacturing processes and the reliable production of peptide-based active pharmaceutical ingredients. We are seller of Z-Gly-Gly-Gly-Gly-Gly-OH. A comprehensive catalog of biochemicals and exclusive custom syntheses for research labs complete the service portfolio. Headquartered in Swi ...
Country: Switzerland   Phone: +41 58 595 2021   Telefax: +41 58 595 2040


Related products:


Language:
english português français deutsch español
svensk norsk italiano 中国 日本語 по-русски




How do you find
new customers?

click here


Xi´an Function Material
FM established in 2002 and headquartered in XI’AN China, mainly engaged in high pure sputtering tar


Syntop Chemical Co Ltd
Syntop chemical Co.,Ltd. is a professional wax supplier from China .We have owned wax fact


Nanjing Shunxiang Pharm
Shunxiang is a comprehensive company specializing in the development, production and marketing of n


Nvichem co.
Novichem is an innovative, customer oriented, globally active importer - exporter and supplier of C


Codexis, Inc.
Is a world leader in providing unique, state-of-the-art enzyme optimization services and developing


New Natural Biotechnolo
New Natural is a Developer, Manufacturer, Exporter and Supplier of herbal extracts. We specialize i


© Copyright 1996 to 2024 by Netvertise GmbH. All rights reserved Amylin (8-37) (rat)