Chemical-Suppliers
The independent directory of chemicals and chemical suppliers and producers.
BuyersGuideChem
BGC » Chemicals A-Z » Amyloid b-Protein (40-1)
pr

Amyloid b-Protein (40-1)

BGC Id:196091753149
CAS No:144409-99-4
Synonyms:amyloid b-protein ; amyloid beta-protein (40-1) ; vvggvmlgiiagknsgvdeaffvlkqhhveygsdhrfead ; human b-amyloid peptide-(40-1) ; amyloid b-protein (40-1) ; amyloid β-protein (40-1) ; amyloid beta-protein fragment 40-1 ; amyloid β-protein fragment 40-1 ; 280:pn: wo0069900 seqid: 960 unclaimed protein ; amyloid beta-protein (40-1) trifluoroacetate ; beta-amyloid (40-1) ; l-aspartic acid,l-valyl-l-valylglycylglycyl-l-valyl-l-methionyl-l-leucylglycyl-l-isoleucyl-l-isoleucyl-l-alanylglycyl-l-lysyl-l-asparaginyl-l-serylglycyl-l-valyl-l-a-aspartyl-l-a-glutamyl-l-alanyl-l-phenylalanyl-l-phenylalanyl-l-valyl-l-leucyl-l-lysyl-l-glutaminyl-l-histidyl-l-histidyl-l-valyl-l-a-glutamyl-l-tyrosylglycyl-l-seryl-l-a-aspartyl-l-histidyl-l-arginyl-l-phenylalanyl-l-a-glutamyl-l-alanyl- ; 766: pn: us20090175821 seqid: 960claimed protein ; amyloid b-protein, fragment 40-1
Molecular Formula:C194H295 N53 O58 S
Molecular Weight:4329.8
EINECS:
Structural Formula

Identify

Synonyms:
amyloid b-protein ; amyloid beta-protein (40-1) ; vvggvmlgiiagknsgvdeaffvlkqhhveygsdhrfead ; human b-amyloid peptide-(40-1) ; amyloid b-protein (40-1) ; amyloid β-protein (40-1) ; amyloid beta-protein fragment 40-1 ; amyloid β-protein fragment 40-1 ; 280:pn: wo0069900 seqid: 960 unclaimed protein ; amyloid beta-protein (40-1) trifluoroacetate ; beta-amyloid (40-1) ; l-aspartic acid,l-valyl-l-valylglycylglycyl-l-valyl-l-methionyl-l-leucylglycyl-l-isoleucyl-l-isoleucyl-l-alanylglycyl-l-lysyl-l-asparaginyl-l-serylglycyl-l-valyl-l-a-aspartyl-l-a-glutamyl-l-alanyl-l-phenylalanyl-l-phenylalanyl-l-valyl-l-leucyl-l-lysyl-l-glutaminyl-l-histidyl-l-histidyl-l-valyl-l-a-glutamyl-l-tyrosylglycyl-l-seryl-l-a-aspartyl-l-histidyl-l-arginyl-l-phenylalanyl-l-a-glutamyl-l-alanyl- ; 766: pn: us20090175821 seqid: 960claimed protein ; amyloid b-protein, fragment 40-1
CAS:
144409-99-4
EINECS:
Molecular Formula:
C194H295 N53 O58 S
MDL:

Properties

Molecular Weight:
4329.8 g·mol−1

Safety Information

Hazard Classes:
WGK Germany:
3
Storage temperature:
-20°C



The following providers cannot be verified precisely. The companies have offered the product in the past, but despite all care, the companies could not confirm it 100 percent!

Bachem AG
About Bachem Bachem is a listed technology-based company focused on peptide chemistry. The company provides a full range of services to the pharma an... Request

What other providers are available for CAS 144409-99-4?

In addition to the providers presented here for Amyloid b-Protein (40-1) with the CAS number 144409-99-4, there are other 16 providers with slightly different product names available for this CAS number.

+1 additional providers that we know from the past
Leap Chem Co., Ltd | BuGuCh & Partners +7 additional providers that we know from the past
+2 additional providers that we know from the past
+2 additional providers that we know from the past
+2 additional providers that we know from the past




Chemical-Suppliers
© Copyright 1996 to 2025 by Netvertise GmbH. All rights reserved. Reproduction of any materials from the site is strictly forbidden without permission.