www.BuyersGuideChem.com - directory for chemicals and chemical suppliers
Productname:

BGC > Chemicals A-Z > pTH (1-34) (bovine)

pTH (1-34) (bovine)

Quick view: Suppliers
BGC Id:
811638383788
CAS No.:
Synonyms:
bovine pth-(1-34) | bovineparathyroidhormone(1-34 | parathyroid hormone (1-34), bovine | l-phenylalanine,l-alanyl-l-valyl-l-seryl-l-a-glutamyl-l-isoleucyl-l-glutaminyl-l-phenylalanyl-l-methionyl-l-histidyl-l-asparaginyl-l-leucylglycyl-l-lysyl-l-histidyl-l-leucyl-l-seryl-l-seryl-l-methionyl-l-a-glutamyl-l-arginyl-l-valyl-l-a-glutamyl-l-tryptophyl-l-leucyl-l-arginyl-l-lysyl-l-lysyl-l-leucyl-l-glutaminyl-l-a-aspartyl-l-valyl-l-histidyl-l-asparaginyl- | ala-val-ser-glu-ile-gln-phe-met-his-asn-leu-gly-lys-his-leu-ser-ser-met-glu-arg-val-glu-trp-leu-arg-lys-lys-leu-gln-asp-val-his-asn-phe | 1-34-bovineparathormone | parathyroid hormone bovine: fragment 1-34 | 1-34-parathormone (ox) | bovine parathyroidhormone-(1-34) | bovine parathormone 1-34 | 1-34-bovine pth | alanine,l-alanyl-l-valyl-l-seryl-l-glutamyl-l-isoleucyl-l-glutaminyl-l-phenylalanyl-l-methionyl-l-histidyl-l-asparaginyl-l-leucylglycyl-l-lysyl-l-histidyl-l-leucyl-l-seryl-l-seryl-l-methionyl-l-glutamyl-l-arginyl-l-valyl-l-glutamyl-l-tryptophyl-l-leucyl-l-arginyl-l-lysyl-l-lysyl-l-leucyl-l-glutaminyl-l-aspartyl-l-valyl-l-histidyl-l-asparaginylphenyl-,l- (8ci) | bpth 1-34 | 1-34 bovine parathyroid hormone | teriparatide | parathyroid hormone fragment 1-34 bovine | pth (1-34) (bovine) | avseiqfmhnlgkhlssmervewlrkklqdvhnf | 20: pn: wo0181415 seqid: 22 claimedprotein
Formula:
C183H288 N54 O50 S2
Molecular Weight:
4108.71

List of Suppliers

Bachem AG

Company type: Leading producer
About Bachem Bachem is a listed technology-based company focused on peptide chemistry. Bachem AG is a seller of H-Lys-Pro-Tyr-OH. The company provides a full range of services to the pharma and biotech industries. It specializes in the development of innovative, efficient manufacturing processes and the reliable production of peptide-based active pharmaceutical ingredients. A comprehensive catalog of biochemicals and exclusive custom syntheses for research labs complete the service portfolio. Bachem AG is supplier for pTH (1-34) (bovine). Headquartered in Swi ...
Country: Switzerland   Phone: +41 58 595 2021   Telefax: +41 58 595 2040

BuGuCh & Partners

Company type: Analytical Institution
We, BuGuCh & Partners, are an international acting and innovative company, leading in developing and manufacturing. We operates major facilities in North America, Europe and the Pacific Rim, as well as facilities in China, Japan and Saudi Arabia operated through joint ventures. We maintain independently or are partners of some production sites in Europe, Asia and South America. We provide 4-Isocyanatobenzoyl chloride as well. BuGuCh & Partners is supplier for pTH (1-34) (bovine). Our global network is a strength. Our products range from natural gas, oil and basic chemi ...
Country: Germany   Phone:   Telefax:

Specification

Solubility:
Soluble in water.
Appearance:
powder

Safety Information

WGK Germany:
3
Storage tempuraturx:
-20°C

Suppliers and manufactures - with identical CAS number as pTH (1-34) (bovine)

For the following products supplier are listed below:
    Parathyroid Hormone (1-34), bovine


Supplier of

Parathyroid Hormone (1-34), bovine

(CAS: 12583-68-5)

Alpha Biopharmaceuticals Co., Ltd.

Company type: Producer
Alabiochem company locates at a beautiful chinese city-SuZhou. We are a professional biochemical company engaged in researching, developing, manufacturing pharmaceutical peptide、new amino acid, peptide synthetic technique and new type of peptide. Moreover, we are focused on nucleic acid and other small organic compounds. Alabiochem company not only provides contact research but custom synthesis service. We supply our chemical product Fmoc-D-Arg(Boc)2-OH.
Country: P.R.China   Phone: +86-411-39042497   Telefax: +86-411-39042693

Leap Chem Co., Ltd

Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production. LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities. As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. We are supplier of 684238-37-7. Our client list includes many m ...
Country: P.R.China   Phone: +852-30606658   Telefax:


Related products:


Language:
english português français deutsch español
svensk norsk italiano 中国 日本語 по-русски




How do you find
new customers?

click here


New Natural Biotechnolo
New Natural is a Developer, Manufacturer, Exporter and Supplier of herbal extracts. We specialize i


Sujalam Chemicals
We are supplying bulk drugs and its intermediates in india


Rech Chemical Co., Ltd.
Twenties years ago, Rech Chemical Co.,Ltd were mainly a solid manganese sulphate supplier. Today, b


ZHIWE ChemTech Co Ltd
Zhi. is a leading company established in 2009, focusing on Active Pharmaceutical Ingredients (API)


Nanjing Fred Technology
Nanjing Fred technology Co., Ltd. is a high-tech enterprise engaged in the R&D, production and


Shree Gayatri Chemicals
Manufacturing company of drug intermediate and organic chemicals.Shree Gayatri Chemicals


© Copyright 1996 to 2024 by Netvertise GmbH. All rights reserved pTH (1-34) (bovine)