www.BuyersGuideChem.com - directory for chemicals and chemical suppliers
Productname:

BGC > Chemicals A-Z > Sermorelin

Sermorelin

Structure
Quick view: Suppliers
BGC Id:
391844204445
CAS No.:
Synonyms:
somatoliberin fragment 1-29 amide, human | growth hormone releasing factor*fragment 1-29 ami | yadaiftnsyrkvlgqlsarkllqdimsr-nh2 | sermorelin acetate | grf (1-29) amide (human) sermorelin | ghrf (1-29), amide, human | sermorelin | sermorelin aceta | grf (1-29) amide (human) | green tea powdered extract
Formula:
C149H246N44O42S
Molecular Weight:
3357.88

Suppliers & Distributors

image supplier ww
registered suppliers of Sermorelin worldwide
Listed are 10 international and reliable suppliers for Sermorelin. They are coming from 3 countries around the world. These vendors belong to 6 different business types like 'Bulk chemical supplier' and 'Supplier'
Please contact all the below listed distributors/manufacturers for Sermorelin and ask for prices, package standards and transport possibilities. Our registered distributors will help you to get all necessary information and product specifications.




List of Suppliers

Chemos GmbH & Co. KG

Company type: Supplier of chemical products
Chemos is a leading supplier of chemical specialties for your research and production needs. Everything new starts small and needs specific support during scale up and production. Chemos GmbH & Co. KG is supplier for Sermorelin. With over 25 years of experience in the fine chemical market Chemos is supporting research institutions and chemical companies in Europe and America. We are seller of 4-[[3-[(1E)-2-(4-Cyclobutyl-2-thiazolyl)ethenyl]phenyl]amino]-2,2-diethyl-4-oxobutanoic acid. Chemos is a sourcing and distribution company with a grown and strong network of custom manufacturing companies and chemical producers from around the ...
Country: Germany   Phone: +49-871-966346-0   Telefax: +49-871-966346-13

Hangzhou Dayangchem Co. Ltd.

Company type: Leading producer
Hangzhou DayangChem Co. Ltd is a comprehensive entity which specializes in development, production and trade of pharmaceutical, agrochemical and dyestuff intermediates as well as some special type reagents. We have an own factory and share enterprises. We act also as agent of many chemical factories and promote their products to the international market at very competitive price. We take "Credi first, Clients supreme" as our aim. We are supplier of (1R,5R,6S)-rel-2-Thiabicyclo[3.1.0]hex-3-ene-6-carboxylic acid ethyl ester. Hangzhou Dayangchem Co. Ltd. is supplier for Sermorelin. We expect to cooperate with more partners ...
Country: P.R.China   Phone: +86-571-88938639   Telefax: +86-571-8893-8652

Nebula Chemicals Co, Ltd.

Company type: Producer
Nebula Chemicals Co.,Ltd. is a medium-sized high-tech growing type private enterprise engaged in the science research, industrial production and trade service. Nebula Chemicals Co, Ltd. is supplier for Sermorelin. Nebula Chemicals Co, Ltd. is a seller of 1,3-Propanediol. Located in Hi-tech Industries Development Zone,the company enjoys policy benefit, intensive technology, abundant resources, advantaged traffic conditions. The company has an occupied floor area of 16,500 sq. meters and a high-caliber professional team with 150 employees. The company has established own labora ...
Country: P.R.China   Phone: +86-531-55515146   Telefax: +86-531-55515146

Kinbester Co., Ltd.

Company type: Bulk chemical supplier
Kinbester Co., Limited is a leading technology based supplier of organic chemicals in China. 6-Nitro-2-benzothiazolinone will be also provided by us. The major businesses of our company are: 1. Supply high purity organic reagent. 2. Supply intermediates for pharmaceuticals, agrochemicals, dyestuff, electro-chemicals, cosmetics, perfume etc. 3. Kinbester Co., Ltd. is supplier for Sermorelin. Custom manufacturing and co-developing new chemicals under signing secret agreements. 4. Investment in fields of pharmaceuticals and intermediates ...
Country: P.R.China   Phone: +86-592-5550592   Telefax: +86-592-5550518

Zehao Industry Co., Ltd.

The Shepherd Chemical Company was founded in Norwood, Ohio, in 1916. We are a fourth-generation company and a custom manufacturer of Inorganic Metal Salts and Organic Metal Compounds to the global marketplace. Our long-standing success is built upon technical expertise, supplier reliability, and customer relationships. Our goal is to supply the marketplace with high quality metal compounds as standard or customized products. Zehao Industry Co., Ltd. is supplier for Sermorelin. n-Caproic acid sodium salt is also served by Zehao Industry Co., Ltd.. Our capabilities are comprised of our man ...
Country: P.R.China   Phone: +86-531-81901329   Telefax: +86-531-81901329

LGM Pharma

Company type: Supplier
Supplying the newest API’s and rarest molecules for your R&D needs. Additionally Voglibose is supplied by us. LGM Pharma is supplier for Sermorelin. We at LGM Pharma are leaders in supplying the worlds leading institutions with their raw materials for the research and development of the most cutting edge molecules and API’s. LGM Pharma provides our customers with full support from assistance sourcing the molecules needed for research to finding a manufacturer with the right regulatory capabilities for full product development - from the earl ...
Country: USA   Phone: +1-800-881-8210   Telefax: +1-615-250-9817

Leap Labchem Co., Ltd

Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production. LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities. Leap Labchem Co., Ltd is a seller of (Methacryloxymethyl)methyldimethoxysilane. Leap Labchem Co., Ltd is supplier for Sermorelin. As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. Our client list includes many m ...
Country: P.R.China   Phone: +86-571-87755464   Telefax: +86-571-87756549

Arcadia Biotechnology

We are the leading company in China, to supply nutrtional supplements ingredients, APIs and it's intermediates. We also provide finished product and consulting service. (R)-1-[3,5-bis-(Trifluoromethyl)phenyl]-ethanol is also served by Arcadia Biotechnology. Arcadia Biotechnology is supplier for Sermorelin.
Country: P.R.China   Phone: +86 21 61353236   Telefax: +86 21 61353239

Skyrun Industrial Co., Ltd.

Company type: Leading producer
Skyrun Industrial Co.Limited, established in 2003, a state-controlled company (By Skyrun Corp. Additionally 5,6,7,8-Tetrahydro-2-naphthol is supplied by us. & High Hope) in China, specializing in developing, producing and handing raw pharmaceutical material and intermediates. We have expanded a compositive entity from initially only as a small manufacturer. Skyrun Industrial Co., Ltd. is supplier for Sermorelin. We have extensive knowledge of domestic and international pharmaceutical markets. Our working range can be start from small amount in research stage to big bulk for industrial produc ...
Country: P.R.China   Phone: +86-576-84015261   Telefax: +86-576-84015261

Puyer BioPharma Ltd.

Company type: Manufacturer
Puyer is a high-tech enterprise of biopharma and chemical industry founded by a group of doctors at home and abroad who work together with professional management team.The company specializes in the production, R&D and sales of APIs, intermediates, fine chemicals, nutraceuticals, crop science, animal health, CRO,CMO,CDMO and other products. We are supplier of Hot-melt adhesive ae-48. Puyer BioPharma Ltd. is supplier for Sermorelin. More than 300 kinds of products can be produced in batches, which are widely used in high-end fields such as medicine, chemical industry, ...
Country: P.R.China   Phone: +86 513 89157626   Telefax: +86 513 89158198

Safety Information

WGK Germany:
3
Storage tempuraturx:
-20°C

Most viewed

Within the past time user are also interested in the following chemicals.
Acacia Seyal

Suppliers and manufactures - with identical CAS number as Sermorelin

For the following products supplier are listed below:
    GRF (1-29) amide (human)
    Sermorelin acetate
    Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
    GRF (1-29) amide (human); Sermorelin
    GRF (1-29) amide (human) (GMP)
    H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
    [D-Ala2]-Growth Hormone Releasing Factor, GRF (1-29), amide, human;YaDAIFTNSYRKVLGQLSARKLLQDIMSR-NH2


The following companies are not suppliers of Sermorelin . This companies are suppliers for equal products with the same CAS number. CAS: 86168-78-7


Supplier for

GRF (1-29) amide (human)

(CAS: 86168-78-7)

Chemos GmbH & Co. KG

Company type: Supplier of chemical products
Chemos is a leading supplier of chemical specialties for your research and production needs. We are seller of 4-[[3-[(1E)-2-(4-Cyclobutyl-2-thiazolyl)ethenyl]phenyl]amino]-2,2-diethyl-4-oxobutanoic acid. Everything new starts small and needs specific support during scale up and production. With over 25 years of experience in the fine chemical market Chemos is supporting research institutions and chemical companies in Europe and America. Chemos is a sourcing and distribution company with a grown and strong network of custom manufacturing companies and chemical producers from around the ...
Country: Germany   Phone: +49-871-966346-0   Telefax: +49-871-966346-13

Bachem AG

Company type: Leading producer
About Bachem Bachem is a listed technology-based company focused on peptide chemistry. We are seller of Fmoc-Ser(tBu)-Ser(Psi(Me,Me)pro)-OH. The company provides a full range of services to the pharma and biotech industries. It specializes in the development of innovative, efficient manufacturing processes and the reliable production of peptide-based active pharmaceutical ingredients. A comprehensive catalog of biochemicals and exclusive custom syntheses for research labs complete the service portfolio. Headquartered in Swi ...
Country: Switzerland   Phone: +41 58 595 2021   Telefax: +41 58 595 2040

Supplier for

Sermorelin acetate

(CAS: 86168-78-7)

Chemos GmbH & Co. KG

Company type: Supplier of chemical products
Chemos is a leading supplier of chemical specialties for your research and production needs. Everything new starts small and needs specific support during scale up and production. With over 25 years of experience in the fine chemical market Chemos is supporting research institutions and chemical companies in Europe and America. 4-[[3-[(1E)-2-(4-Cyclobutyl-2-thiazolyl)ethenyl]phenyl]amino]-2,2-diethyl-4-oxobutanoic acid will be also provided by us. Chemos is a sourcing and distribution company with a grown and strong network of custom manufacturing companies and chemical producers from around the ...
Country: Germany   Phone: +49-871-966346-0   Telefax: +49-871-966346-13

Wilshire Technologies, Inc.

Company type: Bulk chemical producer
WILSHIRE TECHNOLOGIES, Inc., is a leader in innovative process chemistry and development, producing value-added reactants, reagents and intermediates at significant cost-savings to our customers. We are seller of 2-Bromo-9-phenyl-9H-fluoren-9-ol. We offer the chemical community a broad range of organic chemicals -- each backed by extensive technical information and service support - as well as custom syntheses -- kilogram to tons -- tailored to our clients' specific needs.
Country: USA   Phone: +1-609-683-1117   Telefax: +1-732-274-0049

Simagchem Corporation

Company type: Bulk chemical producer
Your partner in China for chemicals business. Expertize in supplies and sources of fine, specialty, pharmaceutical chemicals and intermediates. WE offer high quality products and JIT services with instant market intelligence in China, custom synthesis in our 3 production sites, famous principals as Brenntag, Univar,S inopec, Grace, Petrobras, DKSH, Formitex, Evonik, Merck, TCI, Sanofi, Chemo with creditable reputation and business cooperation. Additionally 3-Aminopropyl isopropyl ether is supplied by us.
Country: P.R.China   Phone: +86 592 2680 277   Telefax: +86 592 2680 237

Salsbury Chemicals, Inc.

Company type: Manufacturer and Distributor
For many of us sourcing specialty research chemical is time consuming and daunting task. We are supplier of Boc-Asp(OBzl)-Pro-Arg-AMC. We specialize in Chemical Sourcing and procurement which can optimize your purchasing process for specialty chemical. Additionally, we will evaluate and process your custom synthesis requests to known and reliable suppliers. Benefits of Sourcing with US : • Access to resources : Access to multiple search engines along with Supplier databases.Additionally, we provide acces ...
Country: USA   Phone: +1-(800) 2471800   Telefax:

Supplier for

GRF (1-29) amide (human); Sermorelin

(CAS: 86168-78-7)

Salsbury Chemicals, Inc.

Company type: Manufacturer and Distributor
For many of us sourcing specialty research chemical is time consuming and daunting task. We specialize in Chemical Sourcing and procurement which can optimize your purchasing process for specialty chemical. We are seller of Boc-Asp(OBzl)-Pro-Arg-AMC. Additionally, we will evaluate and process your custom synthesis requests to known and reliable suppliers. Benefits of Sourcing with US : • Access to resources : Access to multiple search engines along with Supplier databases.Additionally, we provide acces ...
Country: USA   Phone: +1-(800) 2471800   Telefax:

Supplier for

GRF (1-29) amide (human) (GMP)

(CAS: 86168-78-7)

Salsbury Chemicals, Inc.

Company type: Manufacturer and Distributor
For many of us sourcing specialty research chemical is time consuming and daunting task. We specialize in Chemical Sourcing and procurement which can optimize your purchasing process for specialty chemical. Additionally, we will evaluate and process your custom synthesis requests to known and reliable suppliers. We sell Boc-Asp(OBzl)-Pro-Arg-AMC as well. Benefits of Sourcing with US : • Access to resources : Access to multiple search engines along with Supplier databases.Additionally, we provide acces ...
Country: USA   Phone: +1-(800) 2471800   Telefax:

Salsbury Chemicals, Inc.

Company type: Manufacturer and Distributor
For many of us sourcing specialty research chemical is time consuming and daunting task. Boc-Asp(OBzl)-Pro-Arg-AMC will be also provided by us. We specialize in Chemical Sourcing and procurement which can optimize your purchasing process for specialty chemical. Additionally, we will evaluate and process your custom synthesis requests to known and reliable suppliers. Benefits of Sourcing with US : • Access to resources : Access to multiple search engines along with Supplier databases.Additionally, we provide acces ...
Country: USA   Phone: +1-(800) 2471800   Telefax:

Salsbury Chemicals, Inc.

Company type: Manufacturer and Distributor
For many of us sourcing specialty research chemical is time consuming and daunting task. We specialize in Chemical Sourcing and procurement which can optimize your purchasing process for specialty chemical. Salsbury Chemicals, Inc. also offers Boc-Asp(OBzl)-Pro-Arg-AMC. Additionally, we will evaluate and process your custom synthesis requests to known and reliable suppliers. Benefits of Sourcing with US : • Access to resources : Access to multiple search engines along with Supplier databases.Additionally, we provide acces ...
Country: USA   Phone: +1-(800) 2471800   Telefax:


Related products:


Language:
english português français deutsch español
svensk norsk italiano 中国 日本語 по-русски




How do you find
new customers?

click here


LINOSA Ltd.
Distribution Company for raw materials for Personal Care, Cosmetics and Household products


Sino Rarechem Labs Co.
Sino Rarechem Labs Co.Ltd (one of the leading supplier of building blocks in China ) specialize in


BioClot GmbH
BioClot is a leading manufacturer and distributor specialising in quality Animal Blood Serum and re


Hebei DaPeng Pharm & Ch
Hebei DaPeng Pharm & Chem Co., Ltd. (DPCHEM) has been devoting itself to the business as a prof


Viva Corporation
Viva Corporation is an ISO 9001: 2008 registered manufacturer fatty acid based speciality chemicals


BEYO Chemical Co., Ltd.
BEYO CHEMICAL CO., LTD. is a private joint-stock company in China. We have successful experiences i


© Copyright 1996 to 2019 by Netvertise GmbH. All rights reserved Sermorelin