www.BuyersGuideChem.com - directory for chemicals and chemical suppliers
Productname:

BGC > Chemicals A-Z > Sermorelin

Suppliers for
Sermorelin

image supplier ww
registered suppliers of Sermorelin worldwide
Listed are 15 international and reliable suppliers for Sermorelin. They are coming from 4 countries around the world. These vendors belong to 6 different business types like 'Bulk chemical supplier' and 'Supplier'
Please contact all the below listed distributors/manufacturers for Sermorelin and ask for prices, package standards and transport possibilities. Our registered distributors will help you to get all necessary information and product specifications.




List of Suppliers

Chemos GmbH & Co. KG

Company type: Supplier of chemical products
Chemos is a leading supplier of chemical specialties for your research and production needs. Everything new starts small and needs specific support during scale up and production. Chemos GmbH & Co. KG is supplier for Sermorelin. With over 25 years of experience in the fine chemical market Chemos is supporting research institutions and chemical companies in Europe and America. We are seller of 4-Methylsulfonylbenzylamine hydrochloride. Chemos is a sourcing and distribution company with a grown and strong network of custom manufacturing companies and chemical producers from around the ...
Country: Germany   Phone: +49-9402-9336 0   Telefax: +49-9402-933 613

Hangzhou Dayangchem Co. Ltd.

Company type: Leading producer
Hangzhou DayangChem Co. Ltd is a comprehensive entity which specializes in development, production and trade of pharmaceutical, agrochemical and dyestuff intermediates as well as some special type reagents. We have an own factory and share enterprises. We act also as agent of many chemical factories and promote their products to the international market at very competitive price. We take "Credi first, Clients supreme" as our aim. We are supplier of 2-(Trifluoromethyl)benzhydrol. Hangzhou Dayangchem Co. Ltd. is supplier for Sermorelin. We expect to cooperate with more partners ...
Country: P.R.China   Phone: +86-571-88938639   Telefax: +86-571-8893-8652

Pharmacore Co., Limited

Company type: Producer
PHARMACORE CO., LIMITED is a source for drug and intermediates. The company has research and development facilities to produce organic intermediates that have the potential to become drugs of the future. It offers screening compounds that accelerate drug discovery programs. Pharmacore Co., Limited is supplier for Sermorelin. The company is dedicated to discovering molecules. Following is our Outstanding Service: ØResearch and Development of synthesis for the production of most complex molecules. Additionally 4-[1-(4-Fluorophenyl)-1H-pyrazol-5-yl]-2-pyridinamine is supplied by us. Ø ...
Country: P.R.China   Phone: +86-21-20242659   Telefax: +86-21-20242659

Kinbester Co., Ltd.

Company type: Bulk chemical supplier
Kinbester Co., Limited is a leading technology based supplier of organic chemicals in China. Salicylamide will be also provided by us. The major businesses of our company are: 1. Supply high purity organic reagent. 2. Supply intermediates for pharmaceuticals, agrochemicals, dyestuff, electro-chemicals, cosmetics, perfume etc. 3. Kinbester Co., Ltd. is supplier for Sermorelin. Custom manufacturing and co-developing new chemicals under signing secret agreements. 4. Investment in fields of pharmaceuticals and intermediates ...
Country: P.R.China   Phone: +86-592-5550592   Telefax: +86-592-5550518

Fond Chemical Co.Ltd,

Company type: Producer
Fond Chemical Co.,Ltd, headquartered in Wuxi,China, is a innovator,manufacturer and supplier of specialty chemicals serving pharmaceutical and chemical industry worldwide through a customer-driven approach. The company engage in sourcing and custom synthesis for R&D and commercial production support. The comprehensive products include Fine Chemicals, APIs, Intermediates, Cosmetic material and Lab instruments. Fond Chemical Co.Ltd, is supplier for Sermorelin. Additionally 2-Chloro-5-iodobenzoic acid is supplied by us. Especially the R&D-Pilot site in Wuhan Jinggong Science & ...
Country: P.R.China   Phone: +86-510-66561189   Telefax: +86-510-66561189

LGM Pharma

Company type: Supplier
Supplying the newest API’s and rarest molecules for your R&D needs. Additionally Tirilazad mesylate is supplied by us. LGM Pharma is supplier for Sermorelin. We at LGM Pharma are leaders in supplying the worlds leading institutions with their raw materials for the research and development of the most cutting edge molecules and API’s. LGM Pharma provides our customers with full support from assistance sourcing the molecules needed for research to finding a manufacturer with the right regulatory capabilities for full product development - from the earl ...
Country: USA   Phone: +1-800-881-8210   Telefax: +1-615-250-9817

Leap Labchem Co., Ltd

Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production. LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities. Leap Labchem Co., Ltd is a seller of Rhamnocitrin. Leap Labchem Co., Ltd is supplier for Sermorelin. As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. Our client list includes many m ...
Country: P.R.China   Phone: +86-571-87756549   Telefax: +86-571-87755464

Clearsynth Canada INC.

Company type: Leading producer
Clearsynth is a technology based, research driven enterprise with the World's Largest Inventory of Reference Standards & Research Chemicals. Clearsynth Canada INC. We are supplier of Lopinavir O-beta-D-glucuronide. is supplier for Sermorelin. We aim to enable the research community in accelerated discovery via synthesis of complex and difficult to make compounds. We specialize in Innovative Organic chemistry and synthesis of Unique Complex Molecules, Stable Isotope Labelled compounds, Metabolites, Impurities, Glucuronides, Chiral Compounds, Conjugate Impurities, and Radio ...
Country: Canada   Phone: +1 415 685 4395 (24/7)   Telefax:

Chemieliva Pharmaceutical Co., Ltd.

Company type: Leading producer
Chemieliva is a key hi-tech enterprise, engaged in the field of Pharmaceutical & Intermediates. Chemieliva Pharmaceutical Co., Ltd. is supplier for Sermorelin. Chemieliva is famous for its high technology, and highly-optimized R&D technology, marketing and human resources. Powered by this, Chemieliva is specialized on developing and producing generics drugs and pharmaceutical intermediates. Chemieliva Pharmaceutical Co., Ltd. also offers (S)-(+)-1-Bromo-2-methylbutane. With these advantages, our logistic department will make the goods delivered at customer’s appointed destination safely in the shortest ...
Country: P.R.China   Phone: +86 23 677 702 19   Telefax: +86 23 677 702 20

Amadis Chemical Co., Ltd.

Company type: Leading producer
Amadis Chemical is one of the leading enterprises in medical and health products research,development,manufacture and trading. Established in 2010, Amadis Chemical are adhering to the " Consummate service Convincing honor " Business strategy. We supply our chemical product 1-(4-Iodo-1H-pyrrolo[2,3-b]pyridin-1-yl)-ethanone. Amadis Chemical Co., Ltd. is supplier for Sermorelin. The topping products and service we providing to you base on our strong technical accumulation and outstanding professional quality. Our associated labs, leading by the outstanding chemistry or pharmacy professors ,make us keep a ...
Country: P.R.China   Phone: +86-571-89925085   Telefax: +86-571-89925065

Arcadia Biotechnology

We are the leading company in China, to supply nutrtional supplements ingredients, APIs and it's intermediates. Arcadia Biotechnology is supplier for Sermorelin. We sell Terlipressin as well. We also provide finished product and consulting service.
Country: P.R.China   Phone: +86 21 61353236   Telefax: +86 21 61353239

Skyrun Industrial Co., Ltd.

Company type: Leading producer
Skyrun Industrial Co.Limited, established in 2003, a state-controlled company (By Skyrun Corp. & High Hope) in China, specializing in developing, producing and handing raw pharmaceutical material and intermediates. Skyrun Industrial Co., Ltd. is supplier for Sermorelin. We have expanded a compositive entity from initially only as a small manufacturer. Rare earth oxides is also served by Skyrun Industrial Co., Ltd.. We have extensive knowledge of domestic and international pharmaceutical markets. Our working range can be start from small amount in research stage to big bulk for industrial produc ...
Country: P.R.China   Phone: +86-576-84015261   Telefax: +86-576-84015261

Hangzhou J&H Chemical Co., Ltd.

Company type: Leading producer
J&H Chemical is one of China's leading providers of integrated fine chemical services including offering, research and development, Custom manufacturing business, as well as other Value-added customer services, for diversified range products of chemicals, pharmaceuticals, and specialities. Hangzhou J&H Chemical Co., Ltd. is supplier for Sermorelin. Hangzhou J&H Chemical Co., Ltd. also offers Fmoc-D-4-Cyanophenylalanine. As a highly customer-oriented enterprise, we always believe "Customer first, service foremost", put forward innovation, continuously improve pipeline, integrate our broad range of ...
Country: P.R.China   Phone: +86-571-87396430 / 87396432   Telefax: +86-571-87396431

Acinopeptide Co., Ltd.

Company type: Leading Producer
Acinopeptide Co., Ltd. is supplier for Sermorelin. Additionally Z-Gln-OSu is supplied by us. Acinopeptide is expert on Peptide & Amino Derivatives _________________________________________ PRODUCT LINE: + Pharmaceutical Peptide + cosmetic peptide + catalogue peptides + Antimicrobial Peptides + Amino Acid Derivatives + Alpha-Amino Acids + Beta-Amino Acids + Beta-Homo Amino Acids + Peptide custom synthesis + Nucleotides _________________________________________ OUR ADVANTAGE IN THE ...
Country: P.R.China   Phone: +86 28 61 98 77 05   Telefax: +86 28 61 98 77 05

Puyer (Nantong) BioPharma Co., Ltd.

Puyer is a Hi-Tech Company established in 2002. Puyer (Nantong) BioPharma Co., Ltd. is supplier for Sermorelin. We are supplier of Dimesna. Our company is engaged in R&D, custom synthesis and scale-up production of Fine Chemicals, Intermediates, Amino Acids and Derivatives, Hormones, Peptide and Reagents. We have experienced team engaging in organic synthesis and have our own professional laboratory and pilot scale factory. Puyer has established strong and long term business relationships with many top companies in Europe, America and Asia-Pacific. We are never ...
Country: P.R.China   Phone: +86 513 89157626 / +86 18014398918   Telefax: +86 513 89158198



Related products:

Product Details

Properties: Productname(s) : Sermorelin / Molecular Structure : / Formula : C149H246N44O42S / Molecular Weight : 3357.88 / Synonyms : somatoliberin fragment 1-29 amide, human ; growth hormone releasing factor*fragment 1-29 ami ; yadaiftnsyrkvlgqlsarkllqdimsr-nh2 ; sermorelin acetate ; grf (1-29) amide (human) sermorelin ; ghrf (1-29), amide, human ; sermorelin ; sermorelin aceta ; grf (1-29) amide (human) ; green tea powdered extract / Density : / Boiling Point : / Flash Point : / Melting Point : / Hazard Symbols : / Risk Codes : / Safety : / Superlist Name : / Solubility : / Appearance : / EINECS : / Transport Information : / Source : / Particular : / Availableforms : / Occurrence : / Method : /
... more properties and specification of Sermorelin

Most viewed

Within the past time user are also interested in the following chemicals.
Acacia Seyal

Suppliers and manufactures - with identical CAS number as Sermorelin

For the following products supplier are listed below:
    GRF (1-29) amide (human)
    GRF (1-29) amide (human) (GMP)
    GRF (1-29) amide (human); Sermorelin
    H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
    Sermorelin acetate
    Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
    [D-Ala2]-Growth Hormone Releasing Factor, GRF (1-29), amide, human;YaDAIFTNSYRKVLGQLSARKLLQDIMSR-NH2

Ad for Chemistry Equipment

The following companies are not suppliers of Sermorelin . This companies are suppliers for equal products with the same CAS number. CAS: 86168-78-7

Supplier for

GRF (1-29) amide (human)

(CAS: 86168-78-7)

Chemos GmbH & Co. KG

Company type: Supplier of chemical products
Chemos is a leading supplier of chemical specialties for your research and production needs. We are seller of 4-Methylsulfonylbenzylamine hydrochloride. Everything new starts small and needs specific support during scale up and production. With over 25 years of experience in the fine chemical market Chemos is supporting research institutions and chemical companies in Europe and America. Chemos is a sourcing and distribution company with a grown and strong network of custom manufacturing companies and chemical producers from around the ...
Country: Germany   Phone: +49-9402-9336 0   Telefax: +49-9402-933 613

Bachem AG

Company type: Leading producer
About Bachem Bachem is a listed technology-based company focused on peptide chemistry. We are seller of Fmoc-Ser(tBu)-Ser(Psi(Me,Me)pro)-OH. The company provides a full range of services to the pharma and biotech industries. It specializes in the development of innovative, efficient manufacturing processes and the reliable production of peptide-based active pharmaceutical ingredients. A comprehensive catalog of biochemicals and exclusive custom syntheses for research labs complete the service portfolio. Headquartered in Swi ...
Country: Switzerland   Phone: +41 58 595 2040   Telefax: +41 58 595 2020
Ad for Chemistry Equipment

Supplier for

GRF (1-29) amide (human) (GMP)

(CAS: 86168-78-7)

Salsbury Chemicals, Inc.

Company type: Manufacturer and Distributor
For many of us sourcing specialty research chemical is time consuming and daunting task. We specialize in Chemical Sourcing and procurement which can optimize your purchasing process for specialty chemical. Additionally, we will evaluate and process your custom synthesis requests to known and reliable suppliers. We provide Benzoic acid,2-[1-[(2S,4S)-4-[(3-amino-2,3,6-trideoxy-a-L-lyxo-hexopyranosyl)oxy]-1,2,3,4,6,11-hexahydro-2,5,12-trihydroxy-7-methoxy-6,11-dioxo-2-naphthacenyl]ethylidene]hydrazide,hydrochloride (1:1) as well. Benefits of Sourcing with US : • Access to resources : Access to multiple search engines along with Supplier databases.Additionally, we provide acces ...
Country: USA   Phone: +1-(800) 2471800   Telefax:
Ad for Chemistry Equipment

Supplier for

GRF (1-29) amide (human); Sermorelin

(CAS: 86168-78-7)

Salsbury Chemicals, Inc.

Company type: Manufacturer and Distributor
For many of us sourcing specialty research chemical is time consuming and daunting task. Salsbury Chemicals, Inc. is a seller of Benzoic acid,2-[1-[(2S,4S)-4-[(3-amino-2,3,6-trideoxy-a-L-lyxo-hexopyranosyl)oxy]-1,2,3,4,6,11-hexahydro-2,5,12-trihydroxy-7-methoxy-6,11-dioxo-2-naphthacenyl]ethylidene]hydrazide,hydrochloride (1:1). We specialize in Chemical Sourcing and procurement which can optimize your purchasing process for specialty chemical. Additionally, we will evaluate and process your custom synthesis requests to known and reliable suppliers. Benefits of Sourcing with US : • Access to resources : Access to multiple search engines along with Supplier databases.Additionally, we provide acces ...
Country: USA   Phone: +1-(800) 2471800   Telefax:
Ad for Chemistry Equipment

Salsbury Chemicals, Inc.

Company type: Manufacturer and Distributor
For many of us sourcing specialty research chemical is time consuming and daunting task. We specialize in Chemical Sourcing and procurement which can optimize your purchasing process for specialty chemical. Benzoic acid,2-[1-[(2S,4S)-4-[(3-amino-2,3,6-trideoxy-a-L-lyxo-hexopyranosyl)oxy]-1,2,3,4,6,11-hexahydro-2,5,12-trihydroxy-7-methoxy-6,11-dioxo-2-naphthacenyl]ethylidene]hydrazide,hydrochloride (1:1) is also served by Salsbury Chemicals, Inc.. Additionally, we will evaluate and process your custom synthesis requests to known and reliable suppliers. Benefits of Sourcing with US : • Access to resources : Access to multiple search engines along with Supplier databases.Additionally, we provide acces ...
Country: USA   Phone: +1-(800) 2471800   Telefax:
Ad for Chemistry Equipment

Supplier for

Sermorelin acetate

(CAS: 86168-78-7)

Chemos GmbH & Co. KG

Company type: Supplier of chemical products
Chemos is a leading supplier of chemical specialties for your research and production needs. Everything new starts small and needs specific support during scale up and production. With over 25 years of experience in the fine chemical market Chemos is supporting research institutions and chemical companies in Europe and America. We are seller of 4-Methylsulfonylbenzylamine hydrochloride. Chemos is a sourcing and distribution company with a grown and strong network of custom manufacturing companies and chemical producers from around the ...
Country: Germany   Phone: +49-9402-9336 0   Telefax: +49-9402-933 613

Wilshire Technologies, Inc.

Company type: Bulk chemical producer
WILSHIRE TECHNOLOGIES, Inc., is a leader in innovative process chemistry and development, producing value-added reactants, reagents and intermediates at significant cost-savings to our customers. 2-Bromo-9-phenyl-9H-fluoren-9-ol is also served by Wilshire Technologies, Inc.. We offer the chemical community a broad range of organic chemicals -- each backed by extensive technical information and service support - as well as custom syntheses -- kilogram to tons -- tailored to our clients' specific needs.
Country: USA   Phone: +1-609-683-1117   Telefax: +1-732-274-0049

Simagchem Corporation

Company type: Bulk chemical producer
Your partner in China for chemicals business. Expertize in supplies and sources of fine, specialty, pharmaceutical chemicals and intermediates. WE offer high quality products and JIT services with instant market intelligence in China, custom synthesis in our 3 production sites, famous principals as Brenntag, Univar,S inopec, Grace, Petrobras, DKSH, Formitex, Evonik, Merck, TCI, Sanofi, Chemo with creditable reputation and business cooperation. Simagchem Corporation also offers N-[4-Cyano-3-(trifluoromethyl)phenyl]-3-[(4-fluorophenyl)thio]-2-hydroxy-2-methyl propionamide.
Country: P.R.China   Phone: +86 592 2680 277   Telefax: +86 592 2680 237
Ad for Chemistry Equipment

Salsbury Chemicals, Inc.

Company type: Manufacturer and Distributor
For many of us sourcing specialty research chemical is time consuming and daunting task. We specialize in Chemical Sourcing and procurement which can optimize your purchasing process for specialty chemical. Additionally, we will evaluate and process your custom synthesis requests to known and reliable suppliers. Salsbury Chemicals, Inc. is a seller of Benzoic acid,2-[1-[(2S,4S)-4-[(3-amino-2,3,6-trideoxy-a-L-lyxo-hexopyranosyl)oxy]-1,2,3,4,6,11-hexahydro-2,5,12-trihydroxy-7-methoxy-6,11-dioxo-2-naphthacenyl]ethylidene]hydrazide,hydrochloride (1:1). Benefits of Sourcing with US : • Access to resources : Access to multiple search engines along with Supplier databases.Additionally, we provide acces ...
Country: USA   Phone: +1-(800) 2471800   Telefax:
Ad for Chemistry Equipment

Salsbury Chemicals, Inc.

Company type: Manufacturer and Distributor
For many of us sourcing specialty research chemical is time consuming and daunting task. Benzoic acid,2-[1-[(2S,4S)-4-[(3-amino-2,3,6-trideoxy-a-L-lyxo-hexopyranosyl)oxy]-1,2,3,4,6,11-hexahydro-2,5,12-trihydroxy-7-methoxy-6,11-dioxo-2-naphthacenyl]ethylidene]hydrazide,hydrochloride (1:1) is also served by Salsbury Chemicals, Inc.. We specialize in Chemical Sourcing and procurement which can optimize your purchasing process for specialty chemical. Additionally, we will evaluate and process your custom synthesis requests to known and reliable suppliers. Benefits of Sourcing with US : • Access to resources : Access to multiple search engines along with Supplier databases.Additionally, we provide acces ...
Country: USA   Phone: +1-(800) 2471800   Telefax:


Language:
english português français deutsch español
svensk norsk italiano 中国 日本語 по-русски




How do you find
new customers?

click here


Anderson Development Co
Anderson Development Company is an award winning specialty and custom chemical manufacturer with a


Zhejiang Haining Fengmi
Zhejiang Haining Fengming Chlorophyll Co., Ltd is the leading manufacturer of chlorophyll series pr


Imballaggi Invernizzi S
For over 50 years, Imballaggi Invernizzi Spa has been producing industrial packaging named Fiber Dr


Melford Laboratories Lt
Melford Laboratories is an ISO9001:2008 accredited fine Chemical and Biochemical manufaturer. Our m


Goly Chemical Co., Ltd
Goly Chemical Co., Ltd is a company, with Global focus, specializing in the following: - Active


Honeywell Specialty Che
Honeywell, headquartered in Morris Township, New Jersey, is an advanced technology and manufacturin


© Copyright 1996 to 2018 by Netvertise GmbH. All rights reserved Sermorelin