Gip, human

BGC Id:	331290409407
CAS No:	100040-31-1
Synonyms:
Molecular Formula:
Molecular Weight:
EINECS:

2026 - The most valued supplier

The following 2 notable providers have been checked and can be recommended.

Conscientia Industrial

BOC Sciences

Molecular Weight : 4983.58 Molecular Formula : C226H338N60O66S Canonical SMILES : CCC(C)C(C(=O)NC(CC1=CNC=N1)C(=O)NC(CCC(=O)N)C(=O)NC(CCC(=O)N)C(=O)NC(CC(=O)O)C(=O)NC(CC2=CC=CC=C2)C(=O)NC(C(C)C)C(=O)NC(CC(=O)N)C(=O)NC(CC3=CNC4=CC=CC=C43)C(=O)NC(CC(C)C)C(=O)NC(CC(C)C)C(=O)NC(C)C(=O)NC(CCC(=O)N)C(=O)NC(CCCCN)C(=O)NCC(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CC(=O)N)C(=O)NC(CC(=O)O)C(=O)NC(CC5=CNC6=CC=CC=C65)C(=O)NC(CCCCN)C(=O)NC(CC7=CNC=N7)C(=O)NC(CC(=O)N)C(=O)NC(C(C)CC)C(=O)N

What other providers are available for CAS 100040-31-1?

The last intensive check and update was carried out on 2026/10/01.

CAS:

100040-31-1

EINECS:

Molecular Formula:

MDL:

MFCD00081634

Suppliers

Conscientia Industrial Co., Ltd (Zhejiang Conscientia Pharmaceutical)

Company type: Producer

Conscientia Industrial Co., Ltd (Conscientia Pharm) mainly engages in developing, manufacturing, marketing, APIs (Active Pharmaceutical Ingredients), pharmaceutical intermediates. Conscientia Industrial Co., Ltd (Zhejiang Conscientia Pharmaceutical) also offers Celastrol. Besides, we provide services of custom synthesis and contract manufacturing APIs (Active Pharmaceutical Ingredients), intermediates, fine chemicals for generic and new drugs. Conscientia Industrial aims to be world-class pharmaceutical raw materials supplier through unflagging efforts in quality, i ...

Country: P.R.China Phone: +86 170 9858 0209 Telefax: +86 170 9858 0209

INQUIRY | ORDER

BOC Sciences

Company type: Supplier

Country: USA
Phone: +1-631-485-4226
Telefax: +1-631-614-7828

BOC Sciences provides a wide range of customer services, bulk and specialty compounds to the pharmaceutical, agrochemical and biotechnology industries. We intend to offer you the products and services of the highest quality at the most reasonable, cost efficient prices. Most of our compounds can be supplied ranging from mg to kg and arrive with analytic report. BOC Sciences is a seller of NSP-DMAE-NHS. We hope to add immense value to your research projects!

INQUIRY | ORDER

What other providers are available for CAS 100040-31-1?

In addition to the providers presented here for Gip, human with the CAS number 100040-31-1, there are other 17 providers with slightly different product names available for this CAS number.

Gastric Inhibitory polypeptide (human)

Leap Chem Co., Ltd | BuGuCh & Partners +8 additional providers that we know from the past

GIP, human;YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

+2 additional providers that we know from the past

Gastric Inhibitory polypeptide (human); GIP (human), Glucose-Dependent Insulinotropic polypeptide (human)

+2 additional providers that we know from the past

H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH

+2 additional providers that we know from the past