|
|
|
Exenatide
Synonyms: hgegtftsdlskqmeeeavrlfiewlknggpssgappps-nh2 | exenatide, ac 2993, exendin a, exendina | exendin-4 | exendin-4
exenatide | m.w. 4186.61 c184h282n50o60s | h-his-gly-glu-gly-thr-phe-thr-ser-asp-leu-ser-lys-gln-met-glu-glu-glu-ala-val-arg-leu-phe-ile-glu-trp-leu-lys-asn-gly-gly-pro-ser-ser-gly-ala-pro-pro-pro-ser-nh2
List of Suppliers
Shandong Ench Chemical Co.,Ltd
Company type: Producer
Shandong Ench Chemical Co.Ltd is a professional manufacturers and supplier in the world ,the main product include chemical pharmaceuticals and intermediates, food and feed additives, herbal extracts, agrochemicals and fine chemicals etc.
It is a privet-owned enterprise and located in Zhangqiu industrial park, We believe that quality is the life of our company. Shandong Ench Chemical Co.,Ltd is supplier for Exenatide. is also served by Shandong Ench Chemical Co.,Ltd. We manufacture our products in strict accordance with ISO9001: 2000 quality management system during the whole en ...
Country: P.R.China
Phone: +86-13869131854
Telefax: +86 531-8637666
XD Biochem Limited
Company type: Analytical Institution
XD BIOCHEMS is a manufacturer and distributor of Fine Chemicals and Biochemicals in Bulk, Semi-Bulk and Research quantities.
Our business originates from the production and sales of amino acids, amino acid derivatives and peptide reagents. XD Biochem Limited is supplier for Exenatide. XD Biochem Limited is a seller of . With the increasing market demand for biochemical products, we began to produce and sell various glucosides, biological buffers and diagnostic reagents in 2018. Thanks to the rapid development of CRO and CMO in China, we began to produ ...
Country: P.R.China
Phone: +86 13815202715 / +86 513 81163739
Telefax: +86 513 81163733
Conscientia Industrial Co., Ltd (Zhejiang Conscientia Pharmaceutical)
Company type: Producer
Conscientia Industrial Co., Ltd (Conscientia Pharm) mainly engages in developing, manufacturing, marketing, APIs (Active Pharmaceutical Ingredients), pharmaceutical intermediates. Conscientia Industrial Co., Ltd (Zhejiang Conscientia Pharmaceutical) is supplier for Exenatide. We are supplier of 2-(Triphenylphosphoranylidene)propionaldehyde. Besides, we provide services of custom synthesis and contract manufacturing APIs (Active Pharmaceutical Ingredients), intermediates, fine chemicals for generic and new drugs.
Conscientia Industrial aims to be world-class pharmaceutical raw materials supplier through unflagging efforts in quality, i ...
Country: P.R.China
Phone: +86 170 9858 0209
Telefax: +86 170 9858 0209
Bachem AG
Company type: Leading producer
About Bachem
Bachem is a listed technology-based company focused on peptide chemistry. Bachem AG is supplier for Exenatide. The company provides a full range of services to the pharma and biotech industries. It specializes in the development of innovative, efficient manufacturing processes and the reliable production of peptide-based active pharmaceutical ingredients. We are seller of L-(g-O-Bu)-Glu-O-tert-Bu .HCl. A comprehensive catalog of biochemicals and exclusive custom syntheses for research labs complete the service portfolio. Headquartered in Swi ...
Country: Switzerland
Phone: +41 58 595 2021
Telefax: +41 58 595 2040
Skyrun Industrial Co., Ltd.
Company type: Leading producer
Skyrun Industrial Co.Limited, established in 2003, a state-controlled company (By Skyrun Corp. & High Hope) in China, specializing in developing, producing and handing raw pharmaceutical material and intermediates. Skyrun Industrial Co., Ltd. is supplier for Exenatide. We have expanded a compositive entity from initially only as a small manufacturer. We have extensive knowledge of domestic and international pharmaceutical markets. We are supplier of 1,2-Dilauroyl-sn-glycero-3-phosphocholine. Our working range can be start from small amount in research stage to big bulk for industrial produc ...
Country: P.R.China
Phone: +86-576-84015261
Telefax: +86-576-84015261
Xingrui Industry Co., Limited
Company type: Leading producer
Xingrui Industry CO., LTD. 5-Aminopyridine-3-carbonitrile will be also provided by us. is a professional manufacturing enterprise integrating R&D, production and sales. The products involved fine chemicals, pharmaceutical intermediates, dye intermediates, cosmetic raw materials and so on. Xingrui Industry Co., Limited is supplier for Exenatide. The company is ranked among the outstanding producers in the fine chemical industry.
Xingrui Industry always strive to be the most reliable partner of our customers, and strive to build a customer-trusted, socially respected, world-class fi ...
Country: P.R.China
Phone: +86-531-88980365
Telefax: +86-531-88980365
Most viewed
Within the past time user are also interested in the following chemicals.
Lorcaserin hydrochloride hemihydrate
Suppliers and manufactures - with identical CAS number as Exenatide
For the following products supplier are listed below:
Exenatide acetate
Monensin Na
BuGuCh & Partners
Company type: Analytical Institution
We, BuGuCh & Partners, are an international acting and innovative company, leading in developing and manufacturing.
We operates major facilities in North America, Europe and the Pacific Rim, as well as facilities in China, Japan and Saudi Arabia operated through joint ventures.
We maintain independently or are partners of some production sites in Europe, Asia and South America. Ficin is also served by BuGuCh & Partners. Our global network is a strength.
Our products range from natural gas, oil and basic chemi ...
Country: Germany
Phone:
Telefax:
Conscientia Industrial Co., Ltd (Zhejiang Conscientia Pharmaceutical)
Company type: Producer
Conscientia Industrial Co., Ltd (Conscientia Pharm) mainly engages in developing, manufacturing, marketing, APIs (Active Pharmaceutical Ingredients), pharmaceutical intermediates. We sell 2-(Triphenylphosphoranylidene)propionaldehyde as well. Besides, we provide services of custom synthesis and contract manufacturing APIs (Active Pharmaceutical Ingredients), intermediates, fine chemicals for generic and new drugs.
Conscientia Industrial aims to be world-class pharmaceutical raw materials supplier through unflagging efforts in quality, i ...
Country: P.R.China
Phone: +86 170 9858 0209
Telefax: +86 170 9858 0209
Chemos GmbH & Co. KG
Company type: Supplier of chemical products
Chemos is a leading supplier of chemical specialties for your research and production needs. Everything new starts small and needs specific support during scale up and production. With over 25 years of experience in the fine chemical market Chemos is supporting research institutions and chemical companies in Europe and America. Chemos GmbH & Co. KG also offers 1-(Chloromethyl)-4-fluoro-2-isocyanatobenzene. Chemos is a sourcing and distribution company with a grown and strong network of custom manufacturing companies and chemical producers from around the ...
Country: Germany
Phone: +49-871-966346-0
Telefax: +49-871-966346-13
Finetech Industry Limited
Company type: Producer
Finetech Industry Limited is a company in England,which specializing in developing, manufacturing and marketing fine organic compounds and intermediates for the pharmaceutical industry. Most of our products were exported to the North America, Europe and Oceania. We are supplier of 3-Ethoxy-6-methylpyridine-2-carboxylic acid.
Our factory is in China,we supply Fluorochemicals, Pyrimidines, Pyridines, Amines, Nitriles, Carboxylic Acids or Ester, Phenols or Alcohols, Aldehydes, Piperidines, Piperazines, Pyrazines, Boric Acids, Amino Aci ...
Country: P.R.China
Phone: +86-27-8746 5837
Telefax: +86-27-8777 2287
BOC Sciences
Company type: Supplier
BOC Sciences provides a wide range of customer services, bulk and specialty compounds to the pharmaceutical, agrochemical and biotechnology industries. We intend to offer you the products and services of the highest quality at the most reasonable, cost efficient prices. BOC Sciences is a seller of . Most of our compounds can be supplied ranging from mg to kg and arrive with analytic report. We hope to add immense value to your research projects!
Country: USA
Phone: +1-631-485-4226
Telefax: +1-631-614-7828
Gihi Chemicals Co., Limited
Company type: Producer
We are has expanded a compositive entity from initially only as a small manufacturer. The company dedicated to the development, production and marketing of chemicals. Gihi Chemicals Co., Limited also offers (2E)-3-(3,4-dihydroxyphenyl)prop-2-enoic acid.
GIHI CHEMICALS covers whole range from small amount (gram grade) for research to big bulk for industrial production. Synthesis capacity from 1 liter to 5000 liter is available.
GIHI CHEMICALS focus on:
- Organic compounds
- Active Pharmaceutical Ingredient(s)
- Nutritional prod ...
Country: P.R.China
Phone: +86-571-86217390
Telefax: +86-571-86217391
Alpha Biopharmaceuticals Co., Ltd.
Company type: Producer
Alabiochem company locates at a beautiful chinese city-SuZhou. We are a professional biochemical company engaged in researching, developing, manufacturing pharmaceutical peptide、new amino acid, peptide synthetic technique and new type of peptide. Moreover, we are focused on nucleic acid and other small organic compounds. We sell Eptifibatide acetate as well. Alabiochem company not only provides contact research but custom synthesis service.
Country: P.R.China
Phone: +86-411-39042497
Telefax: +86-411-39042693
Leap Chem Co., Ltd
Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production.
LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities. We provide 8-Bromo-2-chloro-7-methoxyquinoline-3-carboxaldehyde as well.
As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner.
Our client list includes many m ...
Country: P.R.China
Phone: +852-30606658
Telefax:
Sancai Industry Co.,Ltd.
Company type: Leading producer
Sancai Industry is involved in supplying of fine chemicals, food and nutrition,personal care, medical intermediate etc, We can also customize chemicals for our customers.Taking advantage of innovative technology and excellent talents and through over 15 years of development,We have stabled good relation with clients in and abroad. Sancai Industry Co.,Ltd. also offers Tetrabutylammonium bromide.
In order to be competitive on the market. We have established the global marketing network, independent research center, testing center, ...
Country: P.R.China
Phone: +86-531-88913079
Telefax: +86-531-88913079
Hangzhou Lingrui Chemical Co., Ltd.
Company type: Producer
Established in 2010, located in Hangzhou Qinglan science park, lingruichem is a technical company mainly focus on the Custom synthesis, manufacturing, sales of chemicals to various industries. Additionally 1-Chloro-5-isoquinolinamine is supplied by us. In our R&D centre, we have a staff of skilled and experienced research chemists. This has enabled us to meet the special requirements of our customers and it has enabled us to provide quality products at competitive prices.
Lingruis credo is committed to your reliable business par ...
Country: P.R.China
Phone: +86-571-88092529
Telefax: +86-571-87334908
Arcadia Biotechnology
Company type: Analytical Institution
We are the leading company in China, to supply nutrtional supplements ingredients, APIs and it's intermediates. Atazanavir will be also provided by us. We also provide finished product and consulting service.
Country: P.R.China
Phone: +86 21 61353236
Telefax: +86 21 61353239
Aecochem Corp.
Company type: Supplier
Xiamen Aeco Chemical Industrial Co., Ltd(Short as Aecochem)
Your Partner in China, a Professional chemical raw material supplier, our main products including the Epxoy Chemical ,Petro Chemical,Pharma Intermediate,Fine Chemicas and Life Science etc. We provide (2S,5R)-5-Methyl-2-(propan-2-yl)cyclohexan-1-one as well.
We consists a team of professional analytical department,complete QC&QA under strict SOPs, experienced sale and after-sale service, efficient logistic support, one-stop service is our great advantage, to benefit ...
Country: P.R.China
Phone: +86-592-5998717
Telefax: +86-592-5554527
Hangzhou Zhongqi Chem Co., Ltd
Company type: Leading producer
Located in Hangzhou National Hi-Tech Industrial Development Zone, zhongqichem is a technical company mainly focus on the Custom synthesis, manufacturing, sales of chemicals to various industries. Hangzhou Zhongqi Chem Co., Ltd also offers Ethyl 1-methylnipecotate.
Our advantage :
1.We do not simply provide chemicals , we provide chemical solutions and expertise;
2.We have trained, highly effective team to solve the problem at the first time;
3.Our QMS (quality management system) ensures the product quality strictly;
4.Stro ...
Country: P.R.China
Phone: +86-571-86976032
Telefax: +86-571-86972162
Shandong SanYoung Industry Co., Ltd
Company type: Analytical Institution
Shandong SanYoung Industry Co., Ltd is a scientific and technological company specializing in research and development, cooperative production and sales of chemical products. The company's main products include: photoinitiator; light stabilizer; polymer retardant; ultraviolet absorbent; fine chemical products and pharmaceutical intermediates, we can also customize chemicals for our customers. We are supplier of Oxalic acid bis[2,4,6-trichloro-6-(pentyloxycarbonyl)phenyl] ester. Our company has a large number of customers with good reputation at home and abroad, ...
Country:
Phone: +86 155-64526813
Telefax: +86 531-56897532
Shandong Minglang Chemical Co., Ltd.
Company type: Analytical Institution
Minglang Chemical is owned by Minglang Group,is a large manufacturer of fine chemicals and cosmetic materials that integrates R&D,production and sales together.It is located in the east of the Nanwang Economic Development District in Linzi,and the west of it is Qilu Petroleum Chemical Group,the east of it is Zijiang Road and the transportation is convenient.The enterprise covers an area of 9,000 square meters and the building area can be 3,200 square meters. We sell as well. In recent years,t ...
Country: P.R.China
Phone: +86-13220566916
Telefax: +86 531 58990167
Lori Industry Co., Ltd
Company type: Producer
Lori industry Co., Ltd was established in 2002 years. It is a large-scale manufacturer integrating R&D, produce and sales. Our products mainly cover fine chemicals, organic intermediates, biological buffers, agricultural fertilizers and other chemicals .
Among them, the sales proportion of organic chemicals and agricultural fertilizers is at the forefront of the domestic market. Phloroglucinol is also served by Lori Industry Co., Ltd. From 2013 to 2022 years, through cooperation with foreign trade companies, customers vis ...
Country:
Phone: +86-13011713125
Telefax: +86-13011713125
polypeptide.ltd
Company type: Laboratory supplier
Polypeptide.ltd provides a full spectrum of high-quality peptide services ranging from Custom Peptide Synthesis (research and cGMP grade with Regular and Express deliveries) to high-throughput Peptide Library service. Dulaglutide will be also provided by us. With access to the state-of-the-art equipment and experienced chemists using the latest technologies, we have delivered over 118,000 custom peptides to more than 3,300 scientists worldwide. Now, we have become the 1st vendor in peptide industry that can deliver ...
Country: P.R.China
Phone: +86 152 1950 7320
Telefax:
Wuhan PharmChem Co., LTD.
Company type: Import & export company
Wuhan PharmChem CO., LTD. has been a premier chemical supplier distributing high-quality chemicals to businesses in various industries for the whole world. Wuhan PharmChem Co., LTD. also offers .
At Wuhan PharmChem, we are committed to excellence.From manufacturing to packaging and delivery, we provide quality, reliability and the highest degree of customer service.Our scope of service is organized/structured around the unique needs of each client.Our mission is establish long-term relationships with our clien ...
Country: P.R.China
Phone: +86 27 85835203
Telefax: +86 27 85835203
Skyrun Industrial Co., Ltd.
Company type: Leading producer
Skyrun Industrial Co.Limited, established in 2003, a state-controlled company (By Skyrun Corp. & High Hope) in China, specializing in developing, producing and handing raw pharmaceutical material and intermediates. We have expanded a compositive entity from initially only as a small manufacturer. We provide 1,2-Dilauroyl-sn-glycero-3-phosphocholine as well. We have extensive knowledge of domestic and international pharmaceutical markets. Our working range can be start from small amount in research stage to big bulk for industrial produc ...
Country: P.R.China
Phone: +86-576-84015261
Telefax: +86-576-84015261
Related products:
|
|
|
How do you find
new customers?
click here
United New Materials Te
UMT focuse to research and produce high purity chemical and materials for application of food, phar
Hangzhou Cherry Pharmac
Hangzhou Cherry Pharmaceutical Technology Co., LTD is a marketing company from China engaged in pha
Health Biochem Technolo
Health Biochem Technology Co., Ltd. (Hong Kong) was founded in 2015, the group headquarters is loca
Cure Biochem
Cure BioChem is a fully integrated biotechnology R&D, manufacturing and marketing Biopolymer Pr
Jiangsu Tetra New Mater
Tetrachem is a high-tech company specialized in R&D, production, sales and technical service of
Anhui Royal Chemical Co
Anhui Royal Chemical Co., Ltd. was founded in 2008. Since our foundation, we have been devoted to t
|
